KEGG   Streptococcus gordonii: SGO_1340Help
Entry
SGO_1340          CDS       T00594                                 

Definition
(GenBank) Phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
sgo  Streptococcus gordonii
Pathway
sgo00010  Glycolysis / Gluconeogenesis
sgo00030  Pentose phosphate pathway
sgo00051  Fructose and mannose metabolism
sgo00052  Galactose metabolism
sgo00680  Methane metabolism
sgo01100  Metabolic pathways
sgo01110  Biosynthesis of secondary metabolites
sgo01120  Microbial metabolism in diverse environments
sgo01130  Biosynthesis of antibiotics
sgo01200  Carbon metabolism
sgo01230  Biosynthesis of amino acids
sgo03018  RNA degradation
Module
sgo_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:sgo00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SGO_1340
   00030 Pentose phosphate pathway
    SGO_1340
   00051 Fructose and mannose metabolism
    SGO_1340
   00052 Galactose metabolism
    SGO_1340
  Energy metabolism
   00680 Methane metabolism
    SGO_1340
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    SGO_1340
Enzymes [BR:sgo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     SGO_1340
Protein phosphatases and associated proteins [BR:sgo01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     SGO_1340
Messenger RNA biogenesis [BR:sgo03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     SGO_1340
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase DAGK_cat Peripla_BP_1
Motif
Other DBs
NCBI-ProteinID: ABV10826
UniProt: A8AXW1
Position
complement(1384370..1385380)
Genome map
AA seq 336 aa AA seqDB search
MKRIAVLTSGGDAPGMNAAIRAVVRKAISEGMEVFGIYDGYAGMVAGSIQPLTAASVGDI
ISRGGTFLHSARYPEFAQKEGQLKGIEQLKKHGIEGVVVIGGDGSYHGAMRLTEHGFPAV
GVPGTIDNDIVGTDFTIGFDTAVTTAMDAIDKIRDTSSSHRRTFVVEVMGRNAGDIALWA
GIATGADEIIVPEEGFKFEEIVASIKHGYEEGKKHNIIVLAEGVMSADEFGEKLKAAGDT
SDLRVTELGHIQRGGSPTARDRVLASRMGAHAVELLKKGIGGVAVGIRNEKMVENPILGT
AEEGALFSLAEDGKIIVNNPHKADLALSSLNRSISI
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgtattgctgttttgaccagtggtggagatgcccctggaatgaatgctgccatc
cgtgcagtagttcgtaaagcgatttctgaaggaatggaagtatttggtatctatgatgga
tatgctggcatggttgcgggttcaattcaaccgttaactgctgcatcagtaggtgatatc
atttctcgaggtggtactttccttcattctgcacgttaccctgaatttgcgcaaaaagaa
ggccaacttaagggaattgagcaattgaaaaaacatggaattgaaggtgtcgtggttatt
ggtggtgacggttcttaccacggtgctatgcgtttgacagagcatggcttcccggctgtt
ggtgtaccaggtacaatcgataatgacatcgttggtactgattttacaattggttttgat
acagcagtaacaacagcaatggatgcgattgacaagattcgtgatacttcatctagtcac
cgtcgtacttttgttgttgaagtaatgggacgtaatgctggagatatcgcgctatgggca
ggtattgctactggtgcagatgagattattgttcctgaagaaggtttcaaatttgaagag
attgtagctagcatcaagcatggatatgaggaaggcaaaaagcataatatcattgttctt
gcagaaggtgttatgtcagcggatgaatttggcgaaaagttaaaagctgctggtgataca
agcgaccttcgtgtaactgagcttggccacatccaacgtggtggttctccaactgctcgt
gaccgtgttcttgcttctcgtatgggagcacatgctgttgaattgcttaaaaaagggatc
ggtggtgtagctgttggtatccgcaatgagaaaatggttgaaaatccaattctcggaaca
gcagaagagggtgcactctttagcttggcggaagatggtaagattatcgtcaacaatccg
cacaaggcagatcttgctttgtctagtctaaatcgtagtatttctatttaa

DBGET integrated database retrieval system