KEGG   Streptococcus gordonii: SGO_1980Help
Entry
SGO_1980          CDS       T00594                                 

Gene name
rplV
Definition
(GenBank) ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
sgo  Streptococcus gordonii
Pathway
sgo03010  Ribosome
Brite
KEGG Orthology (KO) [BR:sgo00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    SGO_1980 (rplV)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:sgo03011]
    SGO_1980 (rplV)
Ribosome [BR:sgo03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    SGO_1980 (rplV)
  Bacteria
    SGO_1980 (rplV)
  Archaea
    SGO_1980 (rplV)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-ProteinID: ABV10160
UniProt: A8AZM0
Position
complement(2034967..2035311)
Genome map
AA seq 114 aa AA seqDB search
MAEITSAKAMARTVRVSPRKSRLILDNIRGKNVADAIAILKFTPNKAAGIIEKVLNSAIA
NAENNFGLEKANLVVSEAFANEGPTMKRFRPRAKGSASPINKRTSHITVVVAEK
NT seq 345 nt NT seq  +upstreamnt  +downstreamnt
atggcagaaattacttcagctaaagcaatggctcgtacagtgcgtgtttcacctcgtaaa
tctcgtcttattcttgacaacattcgtggtaaaaacgtcgctgacgcaatcgcaatcttg
aaattcactccaaacaaagctgctggtattatcgaaaaagtattgaactctgcaatcgct
aatgctgaaaacaactttggtttggaaaaagctaacttggtagtatctgaagctttcgca
aacgaaggaccaactatgaaacgtttccgtccgcgcgctaaaggttcagcttcaccaatc
aacaaacgcacaagccacattactgtggtagttgcagaaaaataa

DBGET integrated database retrieval system