KEGG   Sphaerochaeta pleomorpha: SpiGrapes_0951Help
Entry
SpiGrapes_0951    CDS       T01673                                 

Definition
(GenBank) beta-glucosidase-like glycosyl hydrolase
  KO
K01207  beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
sgp  Sphaerochaeta pleomorpha
Pathway
sgp00520  Amino sugar and nucleotide sugar metabolism
sgp01100  Metabolic pathways
sgp01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:sgp00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    SpiGrapes_0951
 Human Diseases
  Drug resistance
   01501 beta-Lactam resistance
    SpiGrapes_0951
Enzymes [BR:sgp01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     SpiGrapes_0951
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_3 DUF1707 NPM1-C
Motif
Other DBs
NCBI-ProteinID: AEV28777
UniProt: G8QRC4
Position
complement(1039849..1041378)
Genome map
AA seq 509 aa AA seqDB search
MDDAQKIGQHFVCGFPGTSLDESFKEAVHTYKIANIILFARNIESKGQVRQLCQDIQELV
QKECGTPALICIDQEGGMVTRLSSDCTNVPGAMALSATGEVNSVFEAGALTGRELRALGI
NCDLAPCLDVNSNKNNPVIGVRSYGDSEKTVSSFGCAMVEALQSEGVMSVAKHFPGHGDT
HLDSHLDLPWVAGDLQALEEHLYPFRLATFAGVQGIMSSHILFPALEKEKVPATMSRSIL
TDLLKKEMGFKGLVFSDCMEMQAIANYYGTASGSLASLQAGVDLVCISHHVELAIQAIAL
VKEALATGRLDKSEFTASTDKIIKAKVMLSLEKNVPFSEVGSKEHKATAQKLREKSLTLV
RGNILPLGTNPYFVGPRCFLATNVSNERNVPLFASSMAELLGGDYFVCSDNPDSTEIDKI
KATGKDATSIIIGTYNAHLRPGQIDLVHAFVKGKIPVTCIALRNPYDLALVGEGVTAIAA
YEYTQDCFEALSRLLRKEIEATGSLPVQL
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
atggatgatgcacaaaaaataggacagcattttgtctgcggtttccctggtacttccttg
gatgaatccttcaaggaagcggtacatacctataagatagcgaatatcattctctttgcc
aggaatatcgagagcaaagggcaggtaaggcaactttgtcaggatattcaagagcttgtg
cagaaagaatgtggcacgcctgccttgatctgcatagaccaggaaggaggtatggtcacc
cgcctgagcagtgactgcaccaatgtccctggggcaatggcattatcggccacaggcgag
gtgaactcggtttttgaagccggggccctgaccgggcgggaactgagagccttgggtatc
aactgcgatcttgctccctgccttgacgtaaacagcaacaaaaataatccggttatcggg
gtcagaagttacggcgattccgaaaagacggtttcttcctttgggtgtgccatggtcgaa
gcgttgcagagcgaaggggtaatgtccgtagccaagcactttcccggtcatggggatacc
catttggattcccatctcgaccttccctgggtagcaggtgacctgcaggcccttgaggaa
catctgtatcctttcaggttggcaacctttgccggtgtccaggggattatgagcagccac
atcctgtttcctgccctcgaaaaagaaaaggtgcctgcaacgatgagccgttcgatcctt
acggaccttctgaaaaaagaaatgggcttcaaaggcctggttttcagtgattgcatggaa
atgcaggcgattgcaaactattacggcactgcttcgggttctttggcttccctgcaagca
ggggtagaccttgtctgtataagccaccatgtggaattggcaatacaggcaatagcgtta
gtcaaggaggcccttgccacggggagactggacaaaagtgaatttactgcttcgactgac
aaaatcatcaaggccaaggtgatgctttccctggaaaaaaatgtacccttttctgaggtg
ggttcaaaagaacataaggcaactgcccagaagctacgcgaaaagtcgttgaccttggtc
aggggaaacatcctaccgctcggcaccaacccctattttgtcgggccaaggtgttttttg
gcaaccaatgtgtccaatgagcggaatgtgccgctttttgcctcctctatggccgaattg
cttggaggcgattattttgtctgctctgacaaccctgattcgacggaaatagacaagatc
aaggcaacgggaaaagatgcaacctccatcattatcggaacgtacaatgcacatctgcgc
cctggacagattgatctggtacatgcttttgtcaaagggaagatccctgtgacctgtatt
gctttgagaaacccctatgaccttgccttggtaggggagggggtgactgcgatagccgcc
tatgaatatacccaggactgctttgaggccctgtcaagattattgagaaaagagattgag
gcaaccggaagtcttccggtccaactatag

DBGET integrated database retrieval system