KEGG   Sphaerochaeta pleomorpha: SpiGrapes_1151
Entry
SpiGrapes_1151    CDS       T01673                                 

Definition
(GenBank) aerobic-type carbon monoxide dehydrogenase, large subunit CoxL/CutL-like protein
  KO
K00087  xanthine dehydrogenase molybdenum-binding subunit [EC:1.17.1.4]
Organism
sgp  Sphaerochaeta pleomorpha
Pathway
sgp00230  Purine metabolism
sgp01100  Metabolic pathways
sgp01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sgp00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    SpiGrapes_1151
Enzymes [BR:sgp01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.1  With NAD+ or NADP+ as acceptor
    1.17.1.4  xanthine dehydrogenase
     SpiGrapes_1151
SSDB
Motif
Pfam: Ald_Xan_dh_C2 Ald_Xan_dh_C
Other DBs
NCBI-ProteinID: AEV28969
UniProt: G8QSK8
Position
1254855..1257143
AA seq 762 aa
MNIIGTPLNRVDAHEKVSGKAKYTSDLVTGHALIAKVLHSTIANGVVKSFDLTEAWAVSG
VIDIVTCFDVPDIQFPTAGHPWSTEKKHQDIADRKLLNKRVRFYGDDIAAVIAEDEISAI
EAVRKIKVTYEQYAPILTIEDAMKSGAMAIHEEKPDNVVVKSSYEVGSFDEASKEPDLIK
IEGDYDTPIVQHCHIENANSFAYMENGKIVVVSSTQIPHIVRRVCSQALGIGHGDIRIIK
PYIGGGFGNKQDALTEPLNAFLTTRVGGRLVHLEYTREETFNCTRVRHAMKFHIVSYVRK
DGSFAARSIVAYSNQGAYASHAHALVANAVNGFRMMYPVGAIKGEAYTVYTNLPTAGAMR
AYGIPQIGFALESHIEDIVSKAGFDSIAFRKQNMMKLGYVDPGTTITCHSTGLDECIDKG
EHYLHYKEKRALYANQTGPVRKGVGMAIFNYKTGVYPIALETSACRMLLNQDGSLQLQMG
ATEIGQGADTVFSMMAAETIGLSVDKVHIISKQDTDVTPYDTGAYASRQTYVAGMAVKKT
AESFKAKLLEFAAFMLKKEAFDLDIKDNFIVHKNKDEHLLSVAEVAMESCYSMTNSRHIA
AEETHHCTDNTYSFGVCFVEIEVDIPMCQVRVLDIINVHDSGRIINHQTAQGQVHGGMSM
GLGYGLYEHLEFDKKTGRMLNDNLLDYKLMTALDTPELQVAFVETEDPTGPYGNKSLGEP
PVIPVAPAIRNALLNATGVAVDSIPLNPEKLFFAFENAGLIK
NT seq 2289 nt   +upstreamnt  +downstreamnt
atgaacataatcggaacacctttgaacagggtagatgcacatgagaaagtttcaggtaaa
gcaaaatatacaagcgatttggtcacaggccatgcgttgatagcaaaagttttgcatagc
accatcgcaaacggagtggtcaaatccttcgacctcactgaggcctgggcagttagcggg
gttatcgacatcgtaacgtgtttcgatgtaccggacatccagttccccacagccgggcat
ccatggtcgacagaaaagaaacatcaggatattgcggacaggaaactactgaacaaacga
gtcaggttttatggcgatgacattgcagcggtaattgcggaagatgaaatctcagcaatc
gaggcagtaaggaaaatcaaggttacctacgagcaatacgctccaatcctcaccatcgag
gatgcaatgaagagcggtgccatggcaatccatgaagagaaaccagacaatgtagtcgtc
aaatcttcctatgaggtcggttccttcgacgaagctagcaaagaacctgacctgatcaaa
atcgaaggcgactacgacacccctatcgtccagcattgccatattgagaatgcaaactca
ttcgcctatatggagaatggtaaaatcgtcgtggttagctccacccaaatcccacacatt
gtccgcagggtatgttcccaggcccttggcatcgggcatggcgatatccggattatcaag
ccctatatagggggaggattcggaaacaagcaggatgcactcaccgagccgctgaatgcc
tttcttaccacacgggtgggaggacggcttgtccacttggaatacaccagggaagaaacc
ttcaactgcacaagggttcgccatgcaatgaaattccatatcgtcagttatgtccgcaag
gacggaagctttgcagcccgttccatcgttgcttactccaaccaaggcgcttatgcttcg
catgcacacgctttagttgccaatgcagtcaacggcttccgtatgatgtacccggtaggg
gctatcaagggtgaggcctacaccgtctacaccaacctgcctaccgcaggggccatgcgt
gcctatggaattccccagatcggttttgctctggagtcccacatcgaggacattgtttca
aaagcaggtttcgactccatcgctttcaggaaacaaaacatgatgaaactcgggtatgtc
gacccgggtactaccatcacctgccattccacgggattggacgaatgcatcgacaagggg
gagcactatctccactacaaggaaaaacgcgcactctatgcaaaccagaccggccctgtc
agaaaaggtgtcggaatggctatattcaactacaagacaggcgtctatcccatagcgctc
gaaacttctgcctgccgtatgcttctcaaccaagatgggtcgttacagctgcagatggga
gcgactgagatcggccagggggcagacactgtcttctccatgatggccgccgagaccatt
ggcctatctgtcgacaaagtgcatatcatcagtaaacaagataccgatgtaaccccctat
gatacaggtgcctatgcatccaggcagacgtatgttgccgggatggcggttaaaaagaca
gccgaaagtttcaaggcaaagctccttgaatttgcagctttcatgttgaagaaagaagcc
ttcgacctggatatcaaagataacttcattgtccacaaaaacaaggatgagcatttgctt
tctgtcgcagaagtggctatggaatcctgctatagcatgacgaactcccgacacatcgcc
gcagaagaaacccatcactgtacggacaacacctactccttcggcgtctgttttgtcgaa
atcgaggtcgatatccctatgtgccaggtacgggtactcgatatcatcaacgtccatgat
tcaggtaggattatcaaccaccagacagcccaggggcaggtgcatggcggcatgagcatg
ggtcttggctacggactgtatgaacatctggaatttgacaagaagaccggacggatgctg
aacgacaatctccttgactataagttgatgacagcgctcgacactccggaactacaggtc
gcattcgttgagacagaggatcctacagggccttacgggaacaaatcgttgggagaacca
cctgtaattcccgtggcccctgctatacgcaatgccctgctcaacgctaccggcgttgca
gtcgattcgattcctctcaatcccgagaaactgttctttgcgtttgagaatgcaggatta
atcaaataa

DBGET integrated database retrieval system