KEGG   Sphaerochaeta pleomorpha: SpiGrapes_1153
Entry
SpiGrapes_1153    CDS       T01673                                 

Definition
(GenBank) aerobic-type carbon monoxide dehydrogenase, small subunit CoxS/CutS-like protein
  KO
K13480  xanthine dehydrogenase iron-sulfur-binding subunit
Organism
sgp  Sphaerochaeta pleomorpha
Pathway
sgp00230  Purine metabolism
sgp01100  Metabolic pathways
sgp01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sgp00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    SpiGrapes_1153
SSDB
Motif
Pfam: Fer2_2 Fer2 Fer2_3
Other DBs
NCBI-ProteinID: AEV28971
UniProt: G8QSL0
Position
1258036..1258539
AA seq 167 aa
MARKLVTCTINGKKREHSVDIRSSLSDMLRGEEGLDSVKHGCDVGECGACTVLIDGQPFN
SCIYLAIWAEGKTILTLEGLSDTKGTISDIQQAFIDEGAVQCGFCTPGFIMSSLPIIDSD
EAISRDEIRKQISGNLCRCTGYENIVNAIEKTQKKRIEEKKASKEQE
NT seq 504 nt   +upstreamnt  +downstreamnt
atggctaggaaattggttacatgcactatcaatggtaaaaaaagagaacattctgtagac
atccgttcctccctttcggatatgcttcgtggcgaggaagggcttgacagcgtaaaacat
ggttgtgacgttggcgaatgcggtgcatgcaccgtactcattgacggacagccgttcaat
tcatgcatatatctcgctatttgggctgaaggaaaaaccatattgaccttggagggtctc
agcgataccaaaggtaccatctctgatattcagcaggctttcatagatgagggggccgta
caatgtgggttctgtacccctgggttcattatgtcgtcgttgccgatcatagatagtgac
gaggctataagcagagacgagatccgcaagcagatttccggcaatctctgcaggtgcact
ggttacgagaacatcgtcaatgccatcgagaaaacccagaagaaacgaatagaagagaaa
aaagcttccaaagaacaagagtag

DBGET integrated database retrieval system