KEGG   Sphaerochaeta pleomorpha: SpiGrapes_2288Help
Entry
SpiGrapes_2288    CDS       T01673                                 

Definition
(GenBank) homoserine O-succinyltransferase
  KO
K00651  homoserine O-succinyltransferase/O-acetyltransferase [EC:2.3.1.46 2.3.1.31]
Organism
sgp  Sphaerochaeta pleomorpha
Pathway
sgp00270  Cysteine and methionine metabolism
sgp00920  Sulfur metabolism
sgp01100  Metabolic pathways
sgp01110  Biosynthesis of secondary metabolites
sgp01130  Biosynthesis of antibiotics
sgp01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:sgp00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    SpiGrapes_2288
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    SpiGrapes_2288
Enzymes [BR:sgp01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.31  homoserine O-acetyltransferase
     SpiGrapes_2288
    2.3.1.46  homoserine O-succinyltransferase
     SpiGrapes_2288
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HTS DUF4188 GATase
Motif
Other DBs
NCBI-ProteinID: AEV30064
UniProt: G8QSD4
Position
complement(2505890..2506840)
Genome map
AA seq 316 aa AA seqDB search
MPVKTCGGLPAVQTLTEENIFVMTSERAVSQDIRPLRIAILNLMPTKVATETQLLRLIGN
TPLQVETTFLCTATYQSQNTQLSYLKTFYQTFADVQSQQFDGLLVTGAPVETKEFAEVQY
WEELTKILAWAETNVYASLFICWGAQAALHTYYGLEKHPLKKKLFGIFPHSVLQPKNKLV
RGFDDTFFAPHSRHTTVFTEDVHAIEDLEVLSVSKEAGLYLAASKDGRKVFVTGHSEYDD
LTLDNEYRRDLEAGKNPSLPRNYYPDNDSSRAPTVCWRSHANLLFSNWLNYFVYQETPFD
IEKLPEKTKARQPCNF
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atgccagtaaaaacatgcggaggccttcctgccgtccaaacattaactgaggaaaatatc
tttgtcatgaccagtgaacgggctgtttcccaggacatccgaccgctgagaattgccatc
ttgaatctcatgcccaccaaggttgcaacagagacccagctcctccgactgattgggaac
acccctttgcaggtagagacaacgttcctctgcacagcaacctaccagagccaaaacacg
cagctttcctacctcaaaacgttctaccagacctttgccgatgtacaatcccagcagttc
gatgggttgctagtaaccggtgccccggtagagaccaaagaatttgccgaggtccagtat
tgggaggaacttactaaaatccttgcgtgggcggaaaccaatgtctatgcctctcttttt
atctgctggggggcccaggcagccctccatacatactatggattggaaaaacatcctttg
aaaaagaaactcttcggcatattcccccattcggttctccaaccaaagaataaactggtg
cggggattcgatgacactttctttgcaccccatagcaggcataccactgtcttcaccgaa
gatgtccatgccatcgaagaccttgaggtgttgagcgtttcaaaagaggctgggttatat
ctggcagcaagcaaggatggtcggaaggtatttgtaaccggtcatagcgaatatgatgac
ctgactttggacaatgagtaccgcagggatcttgaagcggggaaaaacccttccctgccc
cgtaactattatccagacaatgatagttcccgagcccctacggtttgttggcgatcacat
gccaatctcttgttcagtaactggttgaactatttcgtgtatcaggaaacccctttcgat
attgaaaaattgccagagaaaacaaaagcccggcaaccctgcaatttctga

DBGET integrated database retrieval system