KEGG   Sphaerochaeta pleomorpha: SpiGrapes_2606Help
Entry
SpiGrapes_2606    CDS       T01673                                 

Definition
(GenBank) threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
sgp  Sphaerochaeta pleomorpha
Pathway
sgp00260  Glycine, serine and threonine metabolism
sgp01100  Metabolic pathways
sgp01110  Biosynthesis of secondary metabolites
sgp01120  Microbial metabolism in diverse environments
sgp01130  Biosynthesis of antibiotics
sgp01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:sgp00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SpiGrapes_2606
Enzymes [BR:sgp01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     SpiGrapes_2606
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase DegT_DnrJ_EryC1 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: AEV30367
UniProt: G8QUQ9
Position
complement(2861879..2862901)
Genome map
AA seq 340 aa AA seqDB search
MKCFDLRSDTITKPTEAMRKAMYEAEVGDDVYREDPTTNRLELLGAQLSGKERSLFVSSG
SMGNLISLYINGGRSNEVLTASNSHIIQHEIGSVAAIAGVLPIGIDVPRGILTASDLAGK
VKRGCYDMATTTLVEVENTIGGFCYPLENLEEIRDFADSHQLLVHMDGARIFNAQVATGI
PVKTYAKYADTLTFCLSKGLGAPVGSLLCGDEAFINKALTIRKMLGGGIRQSGILAAAGL
YALENHVERLQDDHLHAQAIASALEKAGWAQVDKLGVQTNIIFFTVQGYEATDIVKQLAA
IGILANNEGPMVRLVTNLDLSDEDTDALCKRLETFTLGNN
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgaaatgttttgacttaagaagcgacacgattacgaaacccaccgaggcaatgagaaag
gcaatgtatgaagcagaagtcggtgatgatgtctatcgtgaggaccctacgactaacagg
cttgagttgcttggagcccagctttcaggaaaagaacgttcactttttgtctcttccggc
tccatgggaaatctcatcagcctgtatataaacggaggaagaagcaatgaagtcctcact
gcctccaattcccatatcatccaacatgaaattggttctgttgctgcaatcgcaggggtc
ctgcctatcgggattgacgtccccaggggaatactgacagcctccgaccttgcaggaaaa
gtaaaaagaggctgctatgacatggcaaccactaccctggttgaagtggagaataccatc
ggcggattttgttatcccttggaaaaccttgaggagatcagggattttgccgacagccac
cagcttctggtccacatggacggagccaggatattcaacgcacaggttgctaccgggatt
cctgtcaaaacctatgcaaaatatgccgacacccttaccttttgcctttcaaaaggcctg
ggagcccctgtaggaagcctgctctgcggggatgaagcgtttatcaataaagcccttacc
atcaggaaaatgcttggaggtgggatcaggcaaagcgggatccttgctgcagctggactc
tatgccttggaaaaccacgtcgaaagactccaggatgaccacctacatgcccaggcaata
gcctctgcactcgagaaggcaggatgggcccaggtagacaaactgggtgtgcagaccaat
atcatattctttaccgtgcagggctatgaagctacggatatagtcaaacagctggcagca
atcggcatccttgcaaataatgagggaccaatggttcgtctggttacaaaccttgacctt
tcggatgaggatacagatgcactttgcaagcgccttgaaaccttcactttggggaataat
taa

DBGET integrated database retrieval system