KEGG   Streptomyces griseus: SGR_1149Help
Entry
SGR_1149          CDS       T00691                                 

Definition
(GenBank) putative arginase
  KO
K01476  arginase [EC:3.5.3.1]
Organism
sgr  Streptomyces griseus
Pathway
sgr00220  Arginine biosynthesis
sgr00330  Arginine and proline metabolism
sgr01100  Metabolic pathways
sgr01110  Biosynthesis of secondary metabolites
sgr01130  Biosynthesis of antibiotics
sgr01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:sgr00001]
 Metabolism
  Amino acid metabolism
   00220 Arginine biosynthesis
    SGR_1149
   00330 Arginine and proline metabolism
    SGR_1149
Enzymes [BR:sgr01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     SGR_1149
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase DUF4530
Motif
Other DBs
NCBI-ProteinID: BAG17978
Kitasato: SGR1149
UniProt: B1VUD4
Position
complement(1356339..1357256)
Genome map
AA seq 305 aa AA seqDB search
MGRMRTIVVLDAPSNLGLRPPAPGTVPGCYKLAGALREQRIVRRLGALEGGVVVPPRYDL
GDWREGDGVFNAAAIARYTRTLADRIEGHVRAGEFALVLGGDCSIQLGAALALRRIGRYG
LAAVDGSADFRHPGNSDRIGAAGGEELAIATGRGQADLSDIEGLGPYLRDEDVRLFGMRD
EDEDRAELAALKIPHATVGQIRAGGPDTLGRAAVESLETPALDGYWVHLDADVLDPAVMP
AVDSPDDGGLLPHELAPLLRALVSSPRCVGLNVTIYDPDLDPDGTAGALLADLVVDAFTG
TAPEA
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atgggccgtatgcgtacgatcgtggtcctcgacgccccttccaacctcgggctgcgcccg
ccggcccccggcaccgtcccgggctgctacaaactggccggcgccctgcgcgaacagcgg
atcgtgcgccgcctcggagcgctggagggcggcgtcgtcgtcccgccgcgctacgacctg
ggcgactggcgggagggcgacggggtgttcaacgccgccgccatcgcccggtacacccgc
accctcgccgaccgcatcgaaggccacgtacgggccggggagttcgccctggtcctcggc
ggggactgctccatccagctcggcgccgccctggccctgcgccggatcggccgctacgga
ctcgccgccgtcgacgggtcggcggacttccggcaccccggcaacagcgaccggatcggc
gcggccggcggcgaggaactggccatcgccaccggccggggccaggccgacctcagcgac
atcgaagggctcggcccctacctcagggacgaggacgtccgcctcttcggcatgcgggac
gaggacgaggaccgggccgagctcgccgcgctgaagatcccccacgccaccgtcgggcag
atccgcgcggggggcccggacaccctcgggcgggccgcggtggagagcctggagaccccc
gcgctcgacggctactgggtccacctggacgccgacgtcctcgacccggccgtcatgccg
gccgtcgacagccccgacgacggcggcctcctcccgcacgaactcgccccgctgctgcgc
gcgctcgtctcctccccgcgctgcgtcgggctgaacgtcaccatctacgaccccgatctc
gacccggacggcacggcgggcgccctgctcgccgacctcgtcgtcgacgcgttcacgggc
accgccccggaggcctga

DBGET integrated database retrieval system