KEGG   Streptomyces griseus: SGR_1217
Entry
SGR_1217          CDS       T00691                                 

Definition
(GenBank) putative enoyl-CoA hydratase/isomerase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
sgr  Streptomyces griseus
Pathway
sgr00071  Fatty acid degradation
sgr00280  Valine, leucine and isoleucine degradation
sgr00281  Geraniol degradation
sgr00310  Lysine degradation
sgr00360  Phenylalanine metabolism
sgr00362  Benzoate degradation
sgr00380  Tryptophan metabolism
sgr00410  beta-Alanine metabolism
sgr00627  Aminobenzoate degradation
sgr00640  Propanoate metabolism
sgr00650  Butanoate metabolism
sgr00903  Limonene and pinene degradation
sgr00930  Caprolactam degradation
sgr01100  Metabolic pathways
sgr01110  Biosynthesis of secondary metabolites
sgr01120  Microbial metabolism in diverse environments
sgr01212  Fatty acid metabolism
Module
sgr_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:sgr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    SGR_1217
   00650 Butanoate metabolism
    SGR_1217
  09103 Lipid metabolism
   00071 Fatty acid degradation
    SGR_1217
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SGR_1217
   00310 Lysine degradation
    SGR_1217
   00360 Phenylalanine metabolism
    SGR_1217
   00380 Tryptophan metabolism
    SGR_1217
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    SGR_1217
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    SGR_1217
   00281 Geraniol degradation
    SGR_1217
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    SGR_1217
   00627 Aminobenzoate degradation
    SGR_1217
   00930 Caprolactam degradation
    SGR_1217
Enzymes [BR:sgr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     SGR_1217
SSDB
Motif
Pfam: ECH_2 ECH_1 Acetate_kinase
Other DBs
NCBI-ProteinID: BAG18046
Kitasato: SGR1217
UniProt: B1VV62
Position
1436134..1437201
AA seq 355 aa
MTEEHVLVHTEGRTGVVTLNRPKALNALTRTMVETIAAALDRWEHDHGVATVVITGAGER
GLCAGGDIRSIHEDAKAGGKASAAFWRDEYRLNARIARYPKPYVAVMDGIVMGGGVGVSA
HGSVRIVTERSGVAMPETGIGFVPDVGGTYLLALAPGELGTHLALTGAVVGAGDALLCGL
ADHFVPQAELPAFLAALASEAPSAVLPRHVRAAPPGVLEHHRAWIDHCYAADTVEEIVER
LRACDAPAAGEAAATILGRSPTALKVTLAALRRARELGPLERVLEQEYRVSCAALSSLDL
VEGIRAQVIDKDRAPRWKPGTLVEVTDADVARYFAPTGDEGLSLAASDSSQEVPW
NT seq 1068 nt   +upstreamnt  +downstreamnt
atgaccgaggagcacgtgctcgtgcacaccgaggggcgtacgggggtggtgaccctgaac
cgcccgaaggcgctgaacgccctcacccgcacgatggtggagacgatcgcggcggcgctc
gaccggtgggagcacgaccacggggtggcgacggtcgtcatcaccggcgccggtgagcgc
ggtctgtgcgcgggcggcgacatccggtccatccacgaggacgccaaggcgggcgggaag
gcgtcggcggcgttctggcgcgacgagtaccggctcaacgcccgcatcgcccgctatccc
aagccgtacgtggcggtcatggacggcatcgtgatgggcggcggggtcggcgtctcggcg
cacggcagcgtccggatcgtgaccgagcgctccggggtcgccatgccggagaccgggatc
ggcttcgtgccggacgtcgggggcacctacctgctggccctcgcacccggggagctgggc
acccacctcgcgctgacgggtgccgtggtgggggccggtgacgcgctgctgtgcgggctc
gccgaccacttcgtaccgcaggcggagctgcccgcgttcctggcagcgctggcgagcgag
gccccgtcggcggtgctcccccgccacgtccgggccgcgccgcccggggtgctggagcac
caccgtgcctggatcgatcactgctacgccgccgacacggtcgaggagatcgtggagcgg
ctgcgcgcctgtgacgccccggcggcgggtgaggcggcggccacgatcctcggccgctcc
cccaccgcgctgaaggtcactctggccgcgctgcgccgggcgcgcgaactcggcccgctg
gaaagggtgctggagcaggagtaccgcgtctcgtgcgcggccctctcctccctcgacctg
gtggagggcatccgcgcccaggtgatcgacaaggaccgcgcaccccgctggaagcccggc
acgctggtcgaggtcacggacgcggacgtggcccggtacttcgcaccgaccggcgacgag
gggctctccctcgccgcgtccgactcatcgcaggaggtgccctggtga

KEGG   Streptomyces griseus: SGR_1219
Entry
SGR_1219          CDS       T00691                                 

Definition
(GenBank) putative enoyl-CoA hydratase/isomerase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
sgr  Streptomyces griseus
Pathway
sgr00071  Fatty acid degradation
sgr00280  Valine, leucine and isoleucine degradation
sgr00281  Geraniol degradation
sgr00310  Lysine degradation
sgr00360  Phenylalanine metabolism
sgr00362  Benzoate degradation
sgr00380  Tryptophan metabolism
sgr00410  beta-Alanine metabolism
sgr00627  Aminobenzoate degradation
sgr00640  Propanoate metabolism
sgr00650  Butanoate metabolism
sgr00903  Limonene and pinene degradation
sgr00930  Caprolactam degradation
sgr01100  Metabolic pathways
sgr01110  Biosynthesis of secondary metabolites
sgr01120  Microbial metabolism in diverse environments
sgr01212  Fatty acid metabolism
Module
sgr_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:sgr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    SGR_1219
   00650 Butanoate metabolism
    SGR_1219
  09103 Lipid metabolism
   00071 Fatty acid degradation
    SGR_1219
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SGR_1219
   00310 Lysine degradation
    SGR_1219
   00360 Phenylalanine metabolism
    SGR_1219
   00380 Tryptophan metabolism
    SGR_1219
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    SGR_1219
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    SGR_1219
   00281 Geraniol degradation
    SGR_1219
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    SGR_1219
   00627 Aminobenzoate degradation
    SGR_1219
   00930 Caprolactam degradation
    SGR_1219
Enzymes [BR:sgr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     SGR_1219
SSDB
Motif
Pfam: ECH_1 ECH_2
Other DBs
NCBI-ProteinID: BAG18048
Kitasato: SGR1219
UniProt: B1VV64
Position
1438121..1438930
AA seq 269 aa
MNENRTGPSTPGPYSTILVERRGRTALLTLNRPKALNALSLDVMRETVEATEALDRDPDV
GCIVITGSGEKAFAAGADIKEMQPRSYMDMYLSDWFTAWDRLGQLRTPTIAAVRGYALGG
GCELAMLCDLVIASDTAVFGQPEIRLGVIPGIGGSQRLTRAVGKAKAMDLCLTGRNMDAE
EAERAGLVSRIVPDADLLEEALAVAGTVSGRSAPVAMMAKEAVNRAFETTLAEGVRFERR
LFHAVFATEDQKEGMRAFSEKRPAAFTHR
NT seq 810 nt   +upstreamnt  +downstreamnt
atgaacgagaaccgcacgggcccgtccaccccgggcccgtacagcaccatcctggtcgag
cgccggggccgtacggccctgctcaccctgaaccggcccaaggcgctcaacgccctgagc
ctggacgtcatgcgggagaccgtggaggcgacggaggcgctcgaccgcgaccccgatgtc
ggctgcatcgtgatcaccggcagcggggagaaggcgttcgcggccggagcggacatcaag
gagatgcagccgcggagctacatggacatgtacctgagcgactggttcaccgcctgggac
cggctcgggcaactgcgcacgcccacgatcgccgccgtacggggctacgccctgggcggc
ggctgcgagttggcgatgctgtgcgatctggtcatcgcgtcggacacggccgtcttcggg
cagccggagatccggctcggcgtgatcccgggcatcggcggctcccagcggctcacccgg
gcggtcggcaaggccaaggcgatggacctctgcctcaccggccggaacatggacgccgag
gaggcggagcgggccggtctcgtctcccggatcgtgccggacgccgatctgctggaggag
gcgctcgcggtcgcggggacggtctccggtaggtcggcgcccgtcgcgatgatggcgaag
gaggcggtgaaccgggccttcgagacgacgctcgccgaaggtgtgcgcttcgaacgccgc
ctgttccacgcggtgttcgcgacggaggatcagaaggagggcatgcgggcgttctccgag
aagcgtcccgcggcgttcacccaccgctga

KEGG   Streptomyces griseus: SGR_3090
Entry
SGR_3090          CDS       T00691                                 

Definition
(GenBank) putative enoyl-CoA hydratase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
sgr  Streptomyces griseus
Pathway
sgr00071  Fatty acid degradation
sgr00280  Valine, leucine and isoleucine degradation
sgr00281  Geraniol degradation
sgr00310  Lysine degradation
sgr00360  Phenylalanine metabolism
sgr00362  Benzoate degradation
sgr00380  Tryptophan metabolism
sgr00410  beta-Alanine metabolism
sgr00627  Aminobenzoate degradation
sgr00640  Propanoate metabolism
sgr00650  Butanoate metabolism
sgr00903  Limonene and pinene degradation
sgr00930  Caprolactam degradation
sgr01100  Metabolic pathways
sgr01110  Biosynthesis of secondary metabolites
sgr01120  Microbial metabolism in diverse environments
sgr01212  Fatty acid metabolism
Module
sgr_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:sgr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    SGR_3090
   00650 Butanoate metabolism
    SGR_3090
  09103 Lipid metabolism
   00071 Fatty acid degradation
    SGR_3090
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SGR_3090
   00310 Lysine degradation
    SGR_3090
   00360 Phenylalanine metabolism
    SGR_3090
   00380 Tryptophan metabolism
    SGR_3090
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    SGR_3090
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    SGR_3090
   00281 Geraniol degradation
    SGR_3090
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    SGR_3090
   00627 Aminobenzoate degradation
    SGR_3090
   00930 Caprolactam degradation
    SGR_3090
Enzymes [BR:sgr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     SGR_3090
SSDB
Motif
Pfam: ECH_1 ECH_2
Other DBs
NCBI-ProteinID: BAG19919
Kitasato: SGR3090
UniProt: B1VKP1
Position
complement(3596341..3597075)
AA seq 244 aa
MTLIVRTEERGVATLTLDSPANRNALSARLVAQVRDALADCAGDDTVRAVLLTHTGSTFC
AGADLKAPPDPAAFVALMRQIVALPKPVVARVTGHVRAGGLGLLAACDIAVAGEGASFAL
TESRLGLAPAVISLTLLPRVDRAAANRYYLTGERFDAAEAARISLVTEAAENVDQALAPV
LDGLRRASPQGLAASKKLVTATVLRGFDQYAEDLVVRSAALFASDEAKEGMTAFLERRDP
AWVR
NT seq 735 nt   +upstreamnt  +downstreamnt
gtgaccctgatcgtacggacggaggagcggggcgtcgcgaccctgaccctggactccccg
gccaaccgcaacgcgctgtcggcgcggctggtggcgcaggtgcgcgacgccctggcggac
tgtgccggcgacgacaccgtgcgggcggtgctgctgacccacacgggctcgacgttctgc
gccggggcggatctcaaggcgccgccggatccggcggcgttcgtggccctgatgcgccag
atcgtggcgctgccgaaaccggtggtggcccgggtgacgggccatgtccgggcgggcggc
ctgggcctgttggcggcgtgcgacatcgcggtggcgggcgagggggcgtccttcgccctg
acggagtcccgcctgggcctggctccggcggtgatctccctgaccctgctcccgcgcgtg
gaccgcgcggcggcgaaccgctactacctcaccggtgagcgcttcgacgcggcggaggcg
gcgaggatctcgctggtcacggaggccgccgagaacgtcgaccaggccctcgcccccgtc
ctggacggcctgcgccgggcctccccgcaggggctggccgcgtcgaaaaagctggtcacg
gctacggtgctgaggggcttcgaccagtacgccgaagacctcgtcgtccgctccgcagcg
ttgttcgcctccgacgaggcgaaggaggggatgacggccttcctcgaacgacgggacccg
gcatgggtgcggtga

KEGG   Streptomyces griseus: SGR_329
Entry
SGR_329           CDS       T00691                                 

Definition
(GenBank) putative enoyl-CoA hydratase/isomerase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
sgr  Streptomyces griseus
Pathway
sgr00071  Fatty acid degradation
sgr00280  Valine, leucine and isoleucine degradation
sgr00281  Geraniol degradation
sgr00310  Lysine degradation
sgr00360  Phenylalanine metabolism
sgr00362  Benzoate degradation
sgr00380  Tryptophan metabolism
sgr00410  beta-Alanine metabolism
sgr00627  Aminobenzoate degradation
sgr00640  Propanoate metabolism
sgr00650  Butanoate metabolism
sgr00903  Limonene and pinene degradation
sgr00930  Caprolactam degradation
sgr01100  Metabolic pathways
sgr01110  Biosynthesis of secondary metabolites
sgr01120  Microbial metabolism in diverse environments
sgr01212  Fatty acid metabolism
Module
sgr_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:sgr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    SGR_329
   00650 Butanoate metabolism
    SGR_329
  09103 Lipid metabolism
   00071 Fatty acid degradation
    SGR_329
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SGR_329
   00310 Lysine degradation
    SGR_329
   00360 Phenylalanine metabolism
    SGR_329
   00380 Tryptophan metabolism
    SGR_329
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    SGR_329
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    SGR_329
   00281 Geraniol degradation
    SGR_329
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    SGR_329
   00627 Aminobenzoate degradation
    SGR_329
   00930 Caprolactam degradation
    SGR_329
Enzymes [BR:sgr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     SGR_329
SSDB
Motif
Pfam: ECH_2 ECH_1
Other DBs
NCBI-ProteinID: BAG17158
Kitasato: SGR329
UniProt: B1VQ57
Position
complement(355827..356930)
AA seq 367 aa
MNDDLPVLLEKRGTCLHLTLNRPRALNALSHTMVRLLHEALSHAERDDSIASVLLSGAGD
RGLCAGGDIRALHDDARASGRASLEFWRDEYHLNARIARFPKPYVALMDGIVMGGGVGVS
AHSGIRVVTERSRVAMPETAIGFVPDVGGTRLLAKAPGELGTHLALTGRSVGAADAVLCG
LADLHVPAHLLPALAEELGDPTARGASVADVVQRFATEPPAGELVSQRDWIDGCYAADSV
EEILRRLRASGVPAAEAAADELLSKSPLALKVTLAAVRRAARLDSLEAVLDQEFRVSSRA
FEHPDFVEGVRARIIDKDNAPQWKPGSLAEVDDQEVTRFFAPLGPGEQELGLAPGPTDDL
IGGGQGG
NT seq 1104 nt   +upstreamnt  +downstreamnt
atgaacgacgacctgcccgtcctgctggagaagaggggcacatgcctgcacctcacactg
aaccgcccccgggcgctcaacgctctcagccacacgatggtgcgacttctccacgaggcc
ctgtcccacgccgagcgggacgactcgatcgcctcggtgctgctgtccggagccggtgac
cggggcctgtgcgccggcggcgacatccgtgccctgcacgacgacgcacgggcctcgggg
cgggcatctctggagttctggcgtgacgaataccacctcaacgctcgcatcgcccgattc
cccaagccgtacgtcgcactgatggacggcatcgtgatgggcggaggggtcggggtgtcc
gcgcactccggtatccgtgtcgtcaccgagcgctcacgcgtcgccatgcccgagaccgct
atcggcttcgtgcccgatgtcgggggtacccgtctgctggccaaggcccccggcgaactg
ggcactcatctggcgctcaccggccgatccgtcggggcggccgacgccgttctctgtggt
ctggccgatctccacgtccccgctcacctcctgccggccctggccgaggagctgggggat
ccgacggcccggggggcatcggtggcggacgtcgtccagcggttcgccacggagcctccg
gccggcgagctcgtgtcgcaacgcgactggatcgacggttgctacgcggcggacagcgtg
gaggagatcctgcgccgactccgtgcgagcggtgttcccgcggcggaggcggccgcggac
gaactcctgagcaagtcgccgctcgcgctgaaggtgacgctcgccgcggtccgccgggcc
gcccggctcgacagcctggaggccgttctcgaccaggagttccgtgtctccagccgggcg
ttcgaacaccctgacttcgtcgaaggcgtgcgagcccggatcatcgacaaggacaacgcc
ccgcagtggaagccgggctccctcgccgaagtcgacgaccaggaggtcacccggttcttc
gcgccgctcggccccggcgaacaggagctcggactcgctccgggacccacggacgacctc
atcggcgggggacagggcggctag

KEGG   Streptomyces griseus: SGR_5500
Entry
SGR_5500          CDS       T00691                                 

Definition
(GenBank) putative enoyl-CoA hydratase/isomerase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
sgr  Streptomyces griseus
Pathway
sgr00071  Fatty acid degradation
sgr00280  Valine, leucine and isoleucine degradation
sgr00281  Geraniol degradation
sgr00310  Lysine degradation
sgr00360  Phenylalanine metabolism
sgr00362  Benzoate degradation
sgr00380  Tryptophan metabolism
sgr00410  beta-Alanine metabolism
sgr00627  Aminobenzoate degradation
sgr00640  Propanoate metabolism
sgr00650  Butanoate metabolism
sgr00903  Limonene and pinene degradation
sgr00930  Caprolactam degradation
sgr01100  Metabolic pathways
sgr01110  Biosynthesis of secondary metabolites
sgr01120  Microbial metabolism in diverse environments
sgr01212  Fatty acid metabolism
Module
sgr_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:sgr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    SGR_5500
   00650 Butanoate metabolism
    SGR_5500
  09103 Lipid metabolism
   00071 Fatty acid degradation
    SGR_5500
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SGR_5500
   00310 Lysine degradation
    SGR_5500
   00360 Phenylalanine metabolism
    SGR_5500
   00380 Tryptophan metabolism
    SGR_5500
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    SGR_5500
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    SGR_5500
   00281 Geraniol degradation
    SGR_5500
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    SGR_5500
   00627 Aminobenzoate degradation
    SGR_5500
   00930 Caprolactam degradation
    SGR_5500
Enzymes [BR:sgr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     SGR_5500
SSDB
Motif
Pfam: ECH_1 ECH_2 DUF5612
Other DBs
NCBI-ProteinID: BAG22329
Kitasato: SGR5500
UniProt: B1W0R9
Position
complement(6462001..6462744)
AA seq 247 aa
MSVSTSSPLDGVRVVTVDRPPVNALPVQGWYDLADAVRAAGRDPGARCVVLAAAGRGFNA
GVDVKELQRDTGHESLIGANRGCAEAFAAVYGCEVPVVAAVRGFCLGGGIGLVGNADAIV
ASEDAVFGLPELDRGALGAATHLARLVPQHLMRTLYYTSRTVTAAELLAHGSVWRVVPAH
ELMHSALELAAEIAAKDGHLLRLAKAALNGIDPVDVQRSYRFEQGFTFEANLAGTAARVR
DTFGKET
NT seq 744 nt   +upstreamnt  +downstreamnt
atgagtgtctccacctcctcccccctggacggcgtccgcgtcgtcaccgtggaccgtccc
cccgtcaacgcgctccccgtacagggctggtacgacctggccgacgcggtccgggcggcg
ggccgcgatcccggagcccgctgcgtggtcctggccgccgccgggcgcggcttcaacgcg
ggcgtcgacgtcaaggaactgcaacgcgacacggggcacgagtccctcatcggcgccaac
cggggctgcgccgaggcgttcgcggcggtgtacggctgcgaggtgccggtcgtcgcggcg
gtgcgggggttctgcctgggcggcgggatcggactcgtcgggaacgccgacgcgatcgtc
gcgagcgaggacgcggtcttcggcctgccggagctggaccggggagcgctcggcgcggcg
acccacctggcccggctggtcccgcagcacctgatgcgcacgctgtactacacctcccgc
accgtcaccgcggcagagctgctcgcgcacgggtcggtctggcgggtggtaccggcgcac
gaactgatgcattccgcgctggagttggcggcggagatcgccgccaaggacggccatctg
ctgcggctcgccaaggccgcgctgaacggcatcgaccccgtcgacgtacagcgcagctac
cgcttcgagcaggggttcaccttcgaggcgaacctcgccgggaccgccgcccgggtccgc
gacaccttcggcaaggagacctga

KEGG   Streptomyces griseus: SGR_6832
Entry
SGR_6832          CDS       T00691                                 

Definition
(GenBank) putative enoyl-CoA hydratase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
sgr  Streptomyces griseus
Pathway
sgr00071  Fatty acid degradation
sgr00280  Valine, leucine and isoleucine degradation
sgr00281  Geraniol degradation
sgr00310  Lysine degradation
sgr00360  Phenylalanine metabolism
sgr00362  Benzoate degradation
sgr00380  Tryptophan metabolism
sgr00410  beta-Alanine metabolism
sgr00627  Aminobenzoate degradation
sgr00640  Propanoate metabolism
sgr00650  Butanoate metabolism
sgr00903  Limonene and pinene degradation
sgr00930  Caprolactam degradation
sgr01100  Metabolic pathways
sgr01110  Biosynthesis of secondary metabolites
sgr01120  Microbial metabolism in diverse environments
sgr01212  Fatty acid metabolism
Module
sgr_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:sgr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    SGR_6832
   00650 Butanoate metabolism
    SGR_6832
  09103 Lipid metabolism
   00071 Fatty acid degradation
    SGR_6832
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SGR_6832
   00310 Lysine degradation
    SGR_6832
   00360 Phenylalanine metabolism
    SGR_6832
   00380 Tryptophan metabolism
    SGR_6832
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    SGR_6832
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    SGR_6832
   00281 Geraniol degradation
    SGR_6832
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    SGR_6832
   00627 Aminobenzoate degradation
    SGR_6832
   00930 Caprolactam degradation
    SGR_6832
Enzymes [BR:sgr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     SGR_6832
SSDB
Motif
Pfam: ECH_1 ECH_2
Other DBs
NCBI-ProteinID: BAG23661
Kitasato: SGR6832
UniProt: B1VN36
Position
8217675..8218475
AA seq 266 aa
MGGTEHLTVRREGATLVLTLNRPQARNALSLPMLVGLYDGWLAADADDTVRSIVLTGAGG
AFCAGMDLKALAGGGMEGEEYRDRMTADPDLHWKAMLRHHRPRKPVIAAVEGPCVAGGTE
ILQGTDIRVAGAGATFGLFEVRRGLFPIGGSTVRLPRQIPRTHALEMLLTGRPYAADEAA
AIGLIGRVVPDGTALEEALAVAERVNACGPLAVEAVKASVYEGAELTETEALAAELKRGW
PVFATEDAKEGARAFAEKRPPVYRRA
NT seq 801 nt   +upstreamnt  +downstreamnt
atgggcggtacggaacacctcaccgtgcggcgcgaaggcgccacgctggtcctcaccttg
aacagaccgcaggccaggaacgcgctctcgctgccgatgctcgtcggcctgtacgacggc
tggctcgcggccgacgcggacgacacggtccgctccatcgtcctgaccggagcgggcggc
gcgttctgcgccggaatggacctcaaggcgctcgcgggcggcggaatggagggggaggag
taccgggaccggatgacggccgacccggacctccactggaaggcgatgctgcgccaccac
cgcccgcgcaaaccggtgatcgccgccgtggagggcccctgtgtcgcgggcggcaccgag
atcctccagggcaccgacatccgcgtcgccggagcgggagccaccttcgggctcttcgag
gtccgccggggcctcttcccgatcggcggctccaccgtccggctgccccggcagatcccc
cgcacccacgctctcgaaatgcttctcaccggtcgcccctacgccgccgacgaggccgcc
gccatcgggctcatcggcagggtcgtgcccgacgggacggcgctggaggaggccctcgcc
gtcgccgaacgggtcaacgcctgcgggccgctcgcggtcgaggccgtcaaggcctcggtc
tacgagggcgcggagctgaccgagaccgaggcgctggccgccgaactcaagcgcgggtgg
cccgtgttcgccaccgaggacgccaaggagggcgcgcgcgcgttcgccgagaagcgccca
cccgtctaccggcgcgcctga

KEGG   Streptomyces griseus: SGR_993
Entry
SGR_993           CDS       T00691                                 

Definition
(GenBank) putative fatty acid oxidation complex alpha-subunit
  KO
K01782  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
sgr  Streptomyces griseus
Pathway
sgr00071  Fatty acid degradation
sgr00280  Valine, leucine and isoleucine degradation
sgr00281  Geraniol degradation
sgr00310  Lysine degradation
sgr00362  Benzoate degradation
sgr00380  Tryptophan metabolism
sgr00410  beta-Alanine metabolism
sgr00640  Propanoate metabolism
sgr00650  Butanoate metabolism
sgr00903  Limonene and pinene degradation
sgr00930  Caprolactam degradation
sgr01100  Metabolic pathways
sgr01110  Biosynthesis of secondary metabolites
sgr01120  Microbial metabolism in diverse environments
sgr01200  Carbon metabolism
sgr01212  Fatty acid metabolism
Module
sgr_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:sgr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    SGR_993
   00650 Butanoate metabolism
    SGR_993
  09103 Lipid metabolism
   00071 Fatty acid degradation
    SGR_993
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SGR_993
   00310 Lysine degradation
    SGR_993
   00380 Tryptophan metabolism
    SGR_993
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    SGR_993
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    SGR_993
   00281 Geraniol degradation
    SGR_993
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    SGR_993
   00930 Caprolactam degradation
    SGR_993
Enzymes [BR:sgr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     SGR_993
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     SGR_993
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     SGR_993
SSDB
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2 NAD_binding_2 DAO F420_oxidored AlaDh_PNT_C NAD_binding_8 NAD_Gly3P_dh_N UDPG_MGDP_dh_N
Other DBs
NCBI-ProteinID: BAG17822
Kitasato: SGR993
UniProt: B1VTX8
Position
complement(1173578..1175752)
AA seq 724 aa
MTESTTIRWEQDETGVVTLVLDDPNQSANTMNQAFKDSIAAVADRAEAEKDSIRGIIYTS
AKKTFFAGGDLKDMIKVGPENAQDAFDAGNAIKASLRRIETLGKPVVAAINGAALGGGYE
IALACHHRVALDAPGSRIGLPEVTLGLLPAGGGVTRTVRLMGIADALLKVLLQGTQYTPR
RALENGLVHEVAATREEMTEKARAFIDAHPESQQPWDVKGYRIPGGTPSNPKFAANLPAF
PANLKKQLAGAPMPAPRNILAAAVEGSQVDFETALTIEARYFTELVTGQVSKNMIQAFFF
DLQAVNSGANRPGGIPERPVRKVAVLGAGMMGAGIAYSCARAGIDVVLKDVSAEAAAKGK
AYSEKLLAKALSRGRTTEAKRDELLARITPTGDAADLAGCDAVIEAVFEDTALKHKVFQE
IQDVIEPDALLCSNTSTLPITVLAEGVSRPVDFIGLHFFSPVDKMPLVEIIKGERTGDEA
LARAFDLVRRIKKTPIVVNDSRGFFTSRVIGQFINEGVAMVGEGVEPASIEQAAAQSGYP
AKVLSLMDELTLTLPRKIRNETRRAVEEAGGSWPGHPSDEVIDRMVDEFGRTGRSGGAGF
YDYDEDGKRAGLWPGLREHFTGKADGDVPFEDMKERMLFSEALDSVRCLEENVLISVADA
NIGSIMGIGFPPWTGGVLQYINGYEGGLPGFVARARELAERYGDRFLPPALLVEKAEKGE
TFHD
NT seq 2175 nt   +upstreamnt  +downstreamnt
atgaccgagagcaccaccatccgctgggaacaggacgagaccggcgtcgtcaccctcgtc
ctcgacgacccgaaccagtccgccaacacgatgaaccaggccttcaaggactccatcgcg
gccgtcgccgaccgcgccgaggccgagaaggactccatccgcggcatcatctacacctcc
gccaagaagaccttcttcgccggcggcgacctcaaggacatgatcaaggtcggcccggag
aacgcccaggacgccttcgacgccggcaacgccatcaaggcctcgctgcgccgcatcgag
accctcggcaagcccgtcgtcgccgccatcaacggggcggccctcgggggcggttacgag
atcgccctcgcctgccaccaccgcgtcgccctcgatgcccccggctcccgcatcggcctg
cccgaggtcaccctcggcctgctcccggcgggcggcggcgtcacccggaccgtacgcctc
atgggcatcgcggacgccctgctcaaggtgctcctccagggcacccagtacaccccgcgg
cgggccctggagaacggcctggtccacgaagtcgccgccacccgcgaggagatgaccgag
aaggcccgcgccttcatcgacgcccacccggagtcccagcagccctgggacgtcaagggc
taccggatccccggcggcaccccgtccaaccccaagttcgccgccaacctccccgccttc
ccggccaacctgaagaagcagctcgcgggcgcgcccatgcccgccccgcgcaacatcctc
gcggcggccgtcgagggctcccaggtcgacttcgagaccgccctgaccatcgaggcccgg
tacttcaccgagctggtcaccggccaggtctccaagaacatgatccaggcgttcttcttc
gatctccaggccgtcaactccggcgccaaccggccggggggcatcccggagcgcccggtc
cgcaaggtcgccgtgctcggcgccgggatgatgggcgcgggcatcgcctactcctgcgcc
agggccggcatcgacgtcgtcctcaaggacgtctccgccgaagcggccgccaagggcaag
gcctacagcgagaagctgctcgccaaggcgctctcccggggccgtacgacggaggcgaag
cgcgacgagctgctggcccggatcacccccaccggcgacgcggccgacctcgcgggctgc
gacgcggtgatcgaggccgtcttcgaggacacggccctcaagcacaaggtgttccaggag
atccaggacgtcatcgagcccgacgccctgctctgctccaacacctccacgcttcccatc
acggtcctcgccgagggggtctcacgccccgtcgacttcatcggcctgcacttcttctcc
ccggtcgacaagatgccgctggtcgagatcatcaagggcgagcggaccggcgacgaggca
ctggcccgcgccttcgacctcgtacggcgcatcaagaagacgccgatcgtcgtcaacgac
tcccgcggcttcttcacctcccgcgtcatcggccagttcatcaacgagggcgtcgccatg
gtcggcgagggcgtcgagcccgcctcgatcgagcaggccgccgcccagtccggctacccg
gccaaggtgctctccctgatggacgagctgaccctgaccctgccccgcaagatccggaac
gagaccaggcgggcggtggaggaggccggcggcagctggcccgggcacccctccgacgag
gtcatcgaccgcatggtcgacgagttcggccgcacggggcgcagcgggggagcaggcttc
tacgactacgacgaggacggcaagcgcgccggcctctggccgggcctgcgcgagcacttc
accggcaaggccgacggggacgtccccttcgaggacatgaaggagcggatgctcttctcc
gaggcgctggacagcgtccgctgcctggaggagaacgtcctcatctccgtcgcggacgcc
aacatcggctccatcatgggcatcggcttcccgccgtggaccggcggcgtcctccagtac
atcaacgggtacgagggcggcctgcccggcttcgtggcccgcgcccgggaactcgccgag
cgttacggcgaccgcttcctgccgcccgcgctgctggtggagaaggcggagaagggcgag
accttccacgactga

DBGET integrated database retrieval system