KEGG   Streptomyces griseus: SGR_1219
Entry
SGR_1219          CDS       T00691                                 

Definition
(GenBank) putative enoyl-CoA hydratase/isomerase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
sgr  Streptomyces griseus
Pathway
sgr00071  Fatty acid degradation
sgr00280  Valine, leucine and isoleucine degradation
sgr00281  Geraniol degradation
sgr00310  Lysine degradation
sgr00360  Phenylalanine metabolism
sgr00362  Benzoate degradation
sgr00380  Tryptophan metabolism
sgr00410  beta-Alanine metabolism
sgr00627  Aminobenzoate degradation
sgr00640  Propanoate metabolism
sgr00650  Butanoate metabolism
sgr00903  Limonene and pinene degradation
sgr00930  Caprolactam degradation
sgr01100  Metabolic pathways
sgr01110  Biosynthesis of secondary metabolites
sgr01120  Microbial metabolism in diverse environments
sgr01212  Fatty acid metabolism
Module
sgr_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:sgr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    SGR_1219
   00650 Butanoate metabolism
    SGR_1219
  09103 Lipid metabolism
   00071 Fatty acid degradation
    SGR_1219
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SGR_1219
   00310 Lysine degradation
    SGR_1219
   00360 Phenylalanine metabolism
    SGR_1219
   00380 Tryptophan metabolism
    SGR_1219
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    SGR_1219
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    SGR_1219
   00281 Geraniol degradation
    SGR_1219
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    SGR_1219
   00627 Aminobenzoate degradation
    SGR_1219
   00930 Caprolactam degradation
    SGR_1219
Enzymes [BR:sgr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     SGR_1219
SSDB
Motif
Pfam: ECH_1 ECH_2
Other DBs
NCBI-ProteinID: BAG18048
Kitasato: SGR1219
UniProt: B1VV64
Position
1438121..1438930
AA seq 269 aa
MNENRTGPSTPGPYSTILVERRGRTALLTLNRPKALNALSLDVMRETVEATEALDRDPDV
GCIVITGSGEKAFAAGADIKEMQPRSYMDMYLSDWFTAWDRLGQLRTPTIAAVRGYALGG
GCELAMLCDLVIASDTAVFGQPEIRLGVIPGIGGSQRLTRAVGKAKAMDLCLTGRNMDAE
EAERAGLVSRIVPDADLLEEALAVAGTVSGRSAPVAMMAKEAVNRAFETTLAEGVRFERR
LFHAVFATEDQKEGMRAFSEKRPAAFTHR
NT seq 810 nt   +upstreamnt  +downstreamnt
atgaacgagaaccgcacgggcccgtccaccccgggcccgtacagcaccatcctggtcgag
cgccggggccgtacggccctgctcaccctgaaccggcccaaggcgctcaacgccctgagc
ctggacgtcatgcgggagaccgtggaggcgacggaggcgctcgaccgcgaccccgatgtc
ggctgcatcgtgatcaccggcagcggggagaaggcgttcgcggccggagcggacatcaag
gagatgcagccgcggagctacatggacatgtacctgagcgactggttcaccgcctgggac
cggctcgggcaactgcgcacgcccacgatcgccgccgtacggggctacgccctgggcggc
ggctgcgagttggcgatgctgtgcgatctggtcatcgcgtcggacacggccgtcttcggg
cagccggagatccggctcggcgtgatcccgggcatcggcggctcccagcggctcacccgg
gcggtcggcaaggccaaggcgatggacctctgcctcaccggccggaacatggacgccgag
gaggcggagcgggccggtctcgtctcccggatcgtgccggacgccgatctgctggaggag
gcgctcgcggtcgcggggacggtctccggtaggtcggcgcccgtcgcgatgatggcgaag
gaggcggtgaaccgggccttcgagacgacgctcgccgaaggtgtgcgcttcgaacgccgc
ctgttccacgcggtgttcgcgacggaggatcagaaggagggcatgcgggcgttctccgag
aagcgtcccgcggcgttcacccaccgctga

DBGET integrated database retrieval system