KEGG   Streptomyces griseus: SGR_1477
Entry
SGR_1477          CDS       T00691                                 

Definition
(GenBank) putative 3-oxoacyl-CoA thiolase
  KO
K00632  acetyl-CoA acyltransferase [EC:2.3.1.16]
Organism
sgr  Streptomyces griseus
Pathway
sgr00071  Fatty acid degradation
sgr00280  Valine, leucine and isoleucine degradation
sgr00281  Geraniol degradation
sgr00362  Benzoate degradation
sgr00592  alpha-Linolenic acid metabolism
sgr01100  Metabolic pathways
sgr01110  Biosynthesis of secondary metabolites
sgr01120  Microbial metabolism in diverse environments
sgr01212  Fatty acid metabolism
Module
sgr_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:sgr00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    SGR_1477
   00592 alpha-Linolenic acid metabolism
    SGR_1477
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SGR_1477
  09109 Metabolism of terpenoids and polyketides
   00281 Geraniol degradation
    SGR_1477
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    SGR_1477
   00642 Ethylbenzene degradation
    SGR_1477
Enzymes [BR:sgr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.16  acetyl-CoA C-acyltransferase
     SGR_1477
SSDB
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C
Other DBs
NCBI-ProteinID: BAG18306
Kitasato: SGR1477
UniProt: B1VWI0
Position
1723273..1724499
AA seq 408 aa
MPRTIRDVVFVDGVRTPFGKAGPKGIYHETRADDLVVKAIRELLRRNPDLDPKKIDEVAI
AATTQIGDQGLTLGRTAGILAGLPQSVPGYSIDRMCAGALTAVTSTAGSIAFGAYDVVVA
GGVEHMGRHPMGEGVDPNPRFVSEKLVDESALFMGMTAENLHDRYPTITKERADAYAVRS
QEKAAKAYANGKIQQDLVPVSVRRTNAEAGETGWGLVTADEPMRPGTTMESLAGLKTPFR
AHGRVTAGNAAGLNDGATASLLAAEDVARELGLPVRMRLVSYAFAGVEPEVMGYGPIPAT
EKALAQAGLSIEDIGLFEINEAFAVQVLAFLEHYGIADDDARVNQYGGAIAYGHPLASSG
VRLMTQLARQFEEQPEVRYGLTTMCVGFGMGATVVWENPHFNADGGNK
NT seq 1227 nt   +upstreamnt  +downstreamnt
gtgcctcgtaccatccgggacgtcgtcttcgtcgacggcgtccgcaccccgttcggcaaa
gcgggccccaagggcatctaccacgagacccgcgccgacgacctcgtcgtgaaggccatc
cgggagctgctgcgccgcaacccggacctggaccccaagaagatcgacgaggtcgccatc
gccgcgaccacgcagatcggggaccagggcctcacgctgggccgcaccgccggaatcctg
gccggtctgccgcagtccgtccccggctactcgatcgaccgcatgtgcgcgggcgcgctg
accgccgtcacctcgacggccggttccatcgccttcggcgcgtacgacgtcgtcgtggcc
ggtggcgtcgagcacatgggccgccacccgatgggcgagggcgtcgacccgaacccgcgg
ttcgtgtcggagaagctggtcgacgagtccgccctcttcatgggcatgacggcggagaac
ctgcacgaccgctaccccacgatcaccaaggagcgtgccgacgcgtacgcggtgcgttcg
caggagaaggccgccaaggcgtacgccaacggcaagatccagcaggacctggtaccggtc
tcggtgcgccgcaccaacgccgaggcgggcgagacgggctggggcctggtcaccgccgac
gagccgatgcgcccgggcaccaccatggagtcgctggccggtctgaagaccccgttccgc
gcccacggccgggtcacggccggtaacgccgcgggtctcaacgacggcgccaccgcctcg
ctgctcgccgccgaggacgtcgcccgcgagctgggcctcccggtcaggatgcgcctggtc
tcgtacgccttcgcgggcgtcgagccggaggtcatgggctacggcccgatcccggcgacc
gagaaggcgctggcccaggccggcctctccatcgaggacatcggcctcttcgagatcaac
gaggcgttcgccgtgcaggtgctcgccttcctggagcactacggcatcgcggacgacgac
gcccgcgtcaaccagtacggcggcgccatcgcgtacggccacccgctggcctcctccggt
gtccggctcatgacgcagctggcccggcagttcgaggagcagcccgaggtccgctacggc
ctgacgacgatgtgcgtcggcttcggcatgggcgccacggtcgtctgggagaacccgcac
ttcaacgctgacggaggcaacaagtga

DBGET integrated database retrieval system