KEGG   Streptomyces griseus: SGR_2516Help
Entry
SGR_2516          CDS       T00691                                 

Definition
(GenBank) putative 2-haloalkanoic acid dehalogenase
  KO
K01560  2-haloacid dehalogenase [EC:3.8.1.2]
Organism
sgr  Streptomyces griseus
Pathway
sgr00625  Chloroalkane and chloroalkene degradation
sgr01100  Metabolic pathways
sgr01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sgr00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    SGR_2516
   00361 Chlorocyclohexane and chlorobenzene degradation
    SGR_2516
Enzymes [BR:sgr01000]
 3. Hydrolases
  3.8  Acting on halide bonds
   3.8.1  In carbon-halide compounds
    3.8.1.2  (S)-2-haloacid dehalogenase
     SGR_2516
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hydrolase_like HAD_2 Hydrolase
Motif
Other DBs
NCBI-ProteinID: BAG19345
Kitasato: SGR2516
UniProt: B1W2I1
Position
2972513..2973316
Genome map
AA seq 267 aa AA seqDB search
MAELKIDAVVFDVLGTLVDEPAGLRAGLRALAPPSDTPSPGAGGPGAGGLGAGGAPGTAG
AAGRAGKADGAESAGPGTERLLLLWQRHIEREQRRVLDGDRPYLPSDLLDREAAGVVAEA
AGVEDPAAVEALARSARRLPPWPDTVAGLARIGGGFPLIGLSNASRTALLQLNAHAGLRW
HQALSAEDARTYKPDPAVYRLAVTGSGAPPERLLMVAAHAWDLRGAQALGLRTAYVARPV
GDPPTAADRFDLHARDLTDLAEQLGLS
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atggcagagctgaagatcgacgccgtcgtgttcgacgtgctcggcaccctcgtcgacgaa
cccgccgggctccgcgccggcctccgcgcgctcgccccgccctccgacaccccgtccccc
ggagccggtggccccggtgccggtggccttggtgccggtggcgctcccggaacggccggt
gccgcgggtcgtgccgggaaggccgacggcgcggagagtgccggccccgggaccgagcgg
ctcctgctgctgtggcagcggcacatcgagcgcgagcagcgccgcgtcctcgacggcgac
cggccctacctgcccagcgacctcctcgaccgggaggccgccggggtcgtcgcggaggcc
gccggggtggaggacccggcggcggtggaggcgctcgcccggtcggcccgccggctcccg
ccgtggcccgacaccgtggcggggctcgcccggatcggtggcggcttcccgctgatcggc
ctctccaacgcgagccggacggccctgctgcaactgaacgcccacgccggactgcgctgg
caccaggcgctgtccgccgaggacgcccgcacctacaagccggaccccgccgtctaccgg
ctggccgtcaccggatccggcgcgccgccggagcggctgctgatggtcgccgcccacgcc
tgggacctgcgcggcgcgcaggcgctgggcctgcgcacggcctacgtggcccgcccggtc
ggggacccgcccacggccgcggaccggttcgacctgcacgcgcgggacctgacggacctg
gcggagcagctcgggctctcctga

DBGET integrated database retrieval system