KEGG   Streptomyces griseus: SGR_2545Help
Entry
SGR_2545          CDS       T00691                                 

Definition
(GenBank) putative PfkB-family carbohydrate kinase
  KO
K00874  2-dehydro-3-deoxygluconokinase [EC:2.7.1.45]
Organism
sgr  Streptomyces griseus
Pathway
sgr00030  Pentose phosphate pathway
sgr01100  Metabolic pathways
sgr01120  Microbial metabolism in diverse environments
sgr01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:sgr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    SGR_2545
Enzymes [BR:sgr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.45  2-dehydro-3-deoxygluconokinase
     SGR_2545
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PfkB
Motif
Other DBs
NCBI-ProteinID: BAG19374
Kitasato: SGR2545
UniProt: B1W2L0
Position
complement(3003898..3005073)
Genome map
AA seq 391 aa AA seqDB search
MSGPAAGTADAATSTDVVCLGESMVTFLPSQPGRLADVPSFGRGIGGAESNVACALAAAG
HRAAWVGRVGADGFGDHLVETIASYGVDTSAVRRDPARPTGIYFRTATDRGTDTHEVAYY
RAGSAASAMSPSNVPYEELFAGRVLHLSGITAALSADCLALLRDLTAARPGRPLVSFDVN
HRPRLWRDGEADASVLLELARRADLVFVGEDEAEEAWGIVGAEAIRAALPEPAVVVVKRG
SAGATVFASGLRPGPRSFAAGGAAGPRSSAAGGAGDAAGAGSAGAGGAGGADTVTLVPAL
RVDVVAAVGAGDAFAAGFLSATLRGLPVRERARHGHLMAAAVLTVPGDLTDPPARDHADR
LAALDDEAWGRLRLGPGWTAADRAPEEVRTP
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
gtgtccggacccgcagcagggacggccgacgccgccacgagcaccgatgtcgtctgcctc
ggtgagtccatggtgacgttcctgccctcgcagcccggccgcctcgccgacgtgccctcc
ttcgggcgcgggatcggcggcgccgagtccaacgtggcctgcgccctcgccgccgccgga
caccgggcggcctgggtcggccgcgtcggcgcggacggcttcggcgaccacctcgtcgag
accatcgcgtcgtacggggtcgacacgtcggcggtccgccgggatccggcacggcccacc
ggcatctacttccgcacggccacggaccggggaaccgacacccacgaggtcgcgtactac
cgggcggggtccgccgcctccgcgatgtccccgtcgaacgtgccgtacgaggaactgttc
gcgggccgcgtcctgcacctgtccgggatcacggccgcgctgtccgccgactgcctcgcg
ctgctgcgggacctcacggccgcgcggccggggcgcccgctggtgtcgttcgacgtgaac
caccggccgcgactgtggcgggacggcgaagcggacgcgtccgtgctgctggagctggcc
cgccgcgccgacctcgtgttcgtgggggaggacgaggcggaggaggcctgggggatcgtc
ggcgcggaggcgatccgggcggcgctgccggagccggccgtggtcgtcgtgaagcggggg
agcgccggcgcgacggtgttcgcctcggggctccgccccggaccccgctccttcgccgcc
ggaggggccgccggaccccgctcctcggccgccggaggggccggagacgccgccggagcc
ggatccgcgggagccggaggggctggaggcgccgacaccgtcaccctcgtccccgccctc
cgcgtcgacgtcgtggccgccgtcggggccggagacgcgttcgccgccgggttcctctcc
gccaccctgcgcgggctgcccgtgcgggagcgcgcccggcacgggcacctcatggccgcc
gccgtgctcaccgtccccggcgacctcaccgacccgcccgcccgcgaccacgccgaccgc
ctcgccgctctcgacgacgaggcctgggggagacttcgtctcggccccggctggaccgca
gccgaccgggcccccgaggaggtacgcacaccatga

DBGET integrated database retrieval system