KEGG   Streptomyces griseus: SGR_2552Help
Entry
SGR_2552          CDS       T00691                                 

Definition
(GenBank) hypothetical protein
Organism
sgr  Streptomyces griseus
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: BAG19381
Kitasato: SGR2552
UniProt: B1W2L7
Position
complement(3011754..3012110)
Genome map
AA seq 118 aa AA seqDB search
MSLFRKPQPLAVHVLRDAPELVAGLRRALESATDSDRPGLERALALAEDAAARPDAELRG
RWVRQRLTAAGHEGPADSVEAIKILRRAEPGLTLLQAVTYAKEAKETEASEGGEGAAA
NT seq 357 nt NT seq  +upstreamnt  +downstreamnt
atgagcctgttccggaagccccagcccctcgccgtacacgtcctccgggacgcccccgaa
ctcgtcgccgggctccggcgtgcgctggagagcgccacggactccgaccgccccggactg
gagcgcgccctcgccctggccgaggacgccgccgcgcgcccggacgcggagctgcgcggc
cggtgggtgcggcagcggctcaccgccgccgggcacgagggcccggcggactccgtggag
gccatcaagatcctgcgtcgggccgagcccggactgacgctgctccaggcggtgacgtac
gcgaaggaggcgaaggaaacagaggcgtcggagggcggtgagggggcggcggcctga

DBGET integrated database retrieval system