KEGG   Streptomyces griseus: SGR_2554Help
Entry
SGR_2554          CDS       T00691                                 

Definition
(GenBank) putative aminotransferase
  KO
K14260  alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
sgr  Streptomyces griseus
Pathway
sgr00220  Arginine biosynthesis
sgr00250  Alanine, aspartate and glutamate metabolism
sgr00290  Valine, leucine and isoleucine biosynthesis
sgr01100  Metabolic pathways
sgr01110  Biosynthesis of secondary metabolites
sgr01130  Biosynthesis of antibiotics
sgr01210  2-Oxocarboxylic acid metabolism
sgr01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:sgr00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    SGR_2554
   00290 Valine, leucine and isoleucine biosynthesis
    SGR_2554
   00220 Arginine biosynthesis
    SGR_2554
Enzymes [BR:sgr01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     SGR_2554
    2.6.1.66  valine---pyruvate transaminase
     SGR_2554
Amino acid related enzymes [BR:sgr01007]
 Aminotransferase (transaminase)
  Class I
   SGR_2554
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 DegT_DnrJ_EryC1 Aminotran_5 Cys_Met_Meta_PP Aminotran_3 Beta_elim_lyase
Motif
Other DBs
NCBI-ProteinID: BAG19383
Kitasato: SGR2554
UniProt: B1W2L9
Position
3013451..3014662
Genome map
AA seq 403 aa AA seqDB search
MQVIQSTKLSNVCYEIRGPVLEEAMRLEAAGQRILKLNTGNPAAFGFECPPEILEDILRN
VAGAHGYGDAKGLLSARRAVVQHYQTKGIELDVEDIYLGNGVSELIQMSMQALLDDGDEV
LVPAPDYPLWTASVSLAGGTAVHYRCDEQADWMPDLADVERKITDRTKALVIINPNNPTG
AVYDDEMLRGLTEIARRHNLIVCSDEIYDRILYDGATHTPTAALAPDLMVLTFNGLSKNY
RVAGYRSGWMAVCGPKAHATSYIEGLTILANMRLCANMPSQHAVATALGGRQSIQDLVLP
GGRILEQRDAAYDLLTSIPGVSCVKPKGALYLFPRLDPKVYKIKDDRQMVLDLLRAEKIM
VVQGTGFNWPEPDHFRIVTLPTVEDLTDAVTRIGTFLDGYGQP
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atgcaggtcatccagtccacgaagctctccaacgtctgttacgagatccggggtcccgtg
ctggaggaggcgatgcggctggaagcggccggtcagcgcatcctcaagctgaacacgggc
aaccccgccgccttcgggttcgaatgcccgccggagatcctcgaggacatcctgcgcaac
gtcgcgggcgcgcacggctacggcgacgcgaagggcctgctgtcggcgcgccgcgcggtg
gtgcagcactaccagaccaagggcatcgagctcgacgtcgaggacatctacctgggcaac
ggcgtctccgagctgatccagatgtcgatgcaggcgctgctggacgacggcgacgaggtc
ctcgtaccggctcccgactatccgctgtggaccgcgtcggtctcgctggcgggcgggacg
gccgtgcactaccggtgcgacgagcaggccgactggatgccggacctcgcggacgtcgag
cggaagatcaccgaccgcaccaaggccctggtgatcatcaacccgaacaacccgaccggt
gcggtctacgacgacgagatgctgcgcggtctcaccgagatcgcccggcggcacaacctg
atcgtctgctccgacgagatctacgaccggatcctctacgacggcgcgacccacaccccg
accgcggcgctggccccggacctcatggtgctgaccttcaacgggctctccaagaactac
cgggtcgccggctaccgctccggctggatggccgtctgcggcccgaaggcgcacgccacc
tcgtacatcgaggggctgacgatcctcgccaacatgcggctctgcgccaacatgccctcg
cagcacgcggtggccaccgcgctcggcggccggcagtcgatccaggacctggtgctgccg
ggcggccggatcctggagcagcgggacgcggcgtacgacctgctgacctcgatccccggg
gtgagctgcgtgaagccgaagggggcgctgtacctcttcccccgcctcgaccccaaggtc
tacaagatcaaggacgaccggcagatggtgctggacctgctgcgggccgagaagatcatg
gtggtgcaggggaccggcttcaactggcccgagcccgatcacttccggatcgtcacgctg
ccgacggtggaggacctgaccgacgcggtgaccaggatcggcaccttcctggacggttac
ggacagccctag

DBGET integrated database retrieval system