KEGG   Streptomyces griseus: SGR_2558Help
Entry
SGR_2558          CDS       T00691                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K06888  uncharacterized protein
Organism
sgr  Streptomyces griseus
Brite
KEGG Orthology (KO) [BR:sgr00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    SGR_2558
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thioredox_DsbH Thioredoxin_7 Glyco_hydro_88 Thioredoxin_2
Motif
Other DBs
NCBI-ProteinID: BAG19387
Kitasato: SGR2558
UniProt: B1W2M3
Position
complement(3018394..3020412)
Genome map
AA seq 672 aa AA seqDB search
MNRLADETSPYLLQHADNPVDWWPWSPEAFAEARERGVPVLLSVGYSSCHWCHVMAHESF
EDETVATYLNAHFVPVKVDREERPDIDAVYMEAVQAATGHGGWPMTVFLTPDAEPFYFGT
YFPPEARHGSPSFQQVLEGVVAAWTDRREEVAEVAERIVADLAGRSLVHGGDGVPGESEI
AQALLGLTREYDEQHGGFGGAPKFPPSMVVEFLLRHYARTGSEGALQMAADTCSAMARGG
IYDQLGGGFARYSVDREWVVPHFEKMLYDNALLCRVYAHLWRTTGSDEARRIALETADFM
VRELRTAEGGFASALDADSEDADGRHVEGAYYVWTPAQLREVLGEDDAAFAAAYFGVTEK
GTFEEGASVLRLPGDTGPVDAARVADVRGRLLAAREERPRPGLDDKVVAAWNGLAIAALA
ETGAYFDRPDLVERATEAADLLVRVHLGEVARLARTSKDGQAGDNAGVLEDYGDVAEGFL
TLAAVTGEGAWLEFAGFLLDIVLEQFTGEGGQLYDTAHDAEQLIRRPQDPTDSATPSGWT
AAAGALLSYAAYTGSEAHRTAAEGALGVVKALGPRVPRFVGWGLAVAEALLDGPREVAVA
GPVGGELHRTALLGRAPGAVVAAGEGPGAGAEFPLLVDRPLVGGEPTAYVCRHFVCDAPT
TDAGELAAKLGG
NT seq 2019 nt NT seq  +upstreamnt  +downstreamnt
gtgaatcgccttgctgatgagacctcgccgtacctgctccagcacgccgacaacccggtc
gactggtggccatggtccccggaggcgttcgcggaggcccgggaacggggggtgccggtg
ctgctgagcgtcggctacagctcctgccactggtgccatgtgatggcccacgagtccttc
gaggacgagaccgtcgccacctacctcaacgcccacttcgtgcccgtgaaggtcgaccgc
gaggagcggcccgacatcgacgccgtctacatggaggccgtccaggcggcgaccgggcac
ggcgggtggccgatgaccgtcttcctcacgccggacgccgaacccttctacttcgggacc
tacttcccgcccgaggcgcggcacggctcgccctccttccagcaggtcctggagggtgtg
gtggccgcctggaccgaccggcgtgaggaggtcgccgaggtggcggagcggatcgtcgcc
gatctggcggggcggtcgctggtccatggcggggacggggtgccgggggagtcggagatc
gcccaggcgctgctcgggctgacccgggagtacgacgagcagcacggcgggttcgggggc
gcgcccaagttcccgccgtccatggtggtggagttcctgctgcggcactacgcccgtacg
gggtcggagggggcgctccagatggccgccgacacctgttcggcgatggccaggggcggg
atctacgaccagctcggcgggggctttgcgcgctactccgtggaccgggagtgggtggtg
ccgcacttcgagaagatgctgtacgacaacgcgctgctctgccgcgtgtacgcccatctg
tggcggaccaccgggtcggacgaggcccggcggatcgccctggagacggccgacttcatg
gtgcgggagctgcggaccgccgagggcggcttcgcctccgcgctggacgcggacagtgag
gacgcggacggcaggcatgtcgagggcgcctactacgtgtggacgcccgcccagctccgt
gaggtgctgggcgaggacgacgccgccttcgccgccgcgtacttcggggtgacggagaag
gggacgttcgaggagggggcgtccgtgctccggctgccgggggacacggggcccgtggac
gccgcccgggtcgcggacgtacggggccggctgctggcggcccgcgaggagcggccgcgc
ccggggctggacgacaaggtggtcgccgcctggaacgggctcgccatcgccgcgctcgcc
gagaccggcgcctacttcgaccggcccgacctcgtggagcgggccacggaggccgccgac
ctgctggtccgggtgcacctgggcgaggtggcccggctggcccgcacctccaaggacggg
caggccggtgacaacgccggggtgctggaggactacggcgatgtcgccgagggcttcctc
acgctggccgcggtgacgggggagggcgcctggctggagttcgccgggttcctgctggac
atcgtgctggagcagttcacgggggagggcggtcagttgtacgacaccgcccatgacgcc
gagcagctcatccggcggccccaggaccccaccgacagcgccaccccgtccgggtggacg
gccgccgccggcgcgctgctctcctacgccgcgtacaccggctccgaggcccatcggacg
gccgccgagggcgcgctcggtgtggtgaaggcgctggggccgcgcgtgccccggttcgtc
ggctgggggctcgcggtggccgaggcgctgctggacgggccccgtgaggtcgccgtcgcc
gggccggtcggcggggagctgcaccgtacggcgctgctggggcgggccccgggtgcggtg
gtcgcggcgggggaggggccgggggcgggggccgagttcccgctgctggtggaccggccg
ctggtgggcggggagccgaccgcgtacgtctgccgccacttcgtctgcgacgcgccgacg
acggatgcgggggagttggcggccaagctgggcgggtga

DBGET integrated database retrieval system