KEGG   Streptomyces griseus: SGR_2569Help
Entry
SGR_2569          CDS       T00691                                 

Definition
(GenBank) putative MarR-family transcriptional regulator
Organism
sgr  Streptomyces griseus
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MarR MarR_2 HTH_27 HTH_IclR HTH_24 RuvB_C HTH_20 TrmB HTH_5 Fe_dep_repress Rrf2 RP-C HxlR BRX
Motif
Other DBs
NCBI-ProteinID: BAG19398
Kitasato: SGR2569
UniProt: B1W2N4
Position
3032413..3032943
Genome map
AA seq 176 aa AA seqDB search
MPPQDMTTAASPSGGAVPEHPGPDRLLDSLQHQVAVFARRAEQTRLGGVGQVRNSMDRAA
YLLLNRLDREGPMGVKALAAGMGIDSSTVTRQVAPLVDTGLVKRTSHPEDGRAVVLQLSP
RGQARLEEVRASRRELMSQVTDGWTQEERDTFCALLTRFNGSLAARQAAYQPPQPD
NT seq 531 nt NT seq  +upstreamnt  +downstreamnt
atgccccctcaggacatgacgactgctgcgtctccttccgggggcgccgtccccgaacac
ccgggccccgaccgcctgctggactccctccagcaccaggtggcggtcttcgcccgccgt
gccgagcagacccgcctcggcggtgtcggccaggtccgcaactcgatggaccgggcggcc
tatctgctgttgaaccggctggaccgggagggcccgatgggcgtcaaggcgctggcggcc
gggatgggcatcgactcctcgacggtgacgcggcaggtcgcgccgctcgtcgacaccggt
ctggtgaagcgcacgtcgcacccggaggacggccgggccgtggtgctccagctctcgccg
cgcggtcaggcccggctggaggaggtccgcgcctcgcggcgtgagctgatgtcccaggtg
acggacggctggacgcaggaggaacgggacacgttctgcgccctgctcacccgcttcaac
gggtcgttggccgcccggcaggccgcgtaccagccgccgcagcccgactga

DBGET integrated database retrieval system