KEGG   Streptomyces griseus: SGR_2572Help
Entry
SGR_2572          CDS       T00691                                 

Definition
(GenBank) putative anti-sigma factor
  KO
K17752  serine/threonine-protein kinase RsbT [EC:2.7.11.1]
Organism
sgr  Streptomyces griseus
Brite
KEGG Orthology (KO) [BR:sgr00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sgr01001]
    SGR_2572
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:sgr03021]
    SGR_2572
Enzymes [BR:sgr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     SGR_2572
Protein kinases [BR:sgr01001]
 Serine/threonine kinases: Other
  Bacterial family
   SGR_2572
Transcription machinery [BR:sgr03021]
 Prokaryotic type
  Bacterial type
   Other transcription-related factors
    RNA polymerase-associated proteins
     SGR_2572
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HATPase_c
Motif
Other DBs
NCBI-ProteinID: BAG19401
Kitasato: SGR2572
UniProt: B1W2N7
Position
3034299..3034721
Genome map
AA seq 140 aa AA seqDB search
MTVPWAAEAPPQTQPITQNDDVVRSRQQVRALAQECRLSLVEQTKFITAASELARNTLVY
GGGGEMRAGLVERHGRRGVAAVFADSGPGIPDTELALTDGWTSGGGLGLGLSGARRLVDD
FVLDTEVERGTTVTIVKWAR
NT seq 423 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgtcccctgggcggccgaggccccgccgcagacacagccgatcacccagaacgat
gacgtcgtacgctcgcggcagcaggtccgcgcgctcgcgcaggagtgccggctgtcactg
gtggagcagacgaagttcatcacggccgccagcgaactcgcccgcaacaccctggtgtac
ggcggcggcggggagatgcgggccgggctggtggagcggcacggccggcgcggggtcgcc
gcggtcttcgcggactccgggcccggcatccccgacaccgagctggccctgaccgacggc
tggacctccgggggcgggctggggctcgggctgagcggggcgcgtcggctggtcgacgac
ttcgtcctggacaccgaggtggagcgcggcaccaccgtcaccatcgtcaagtgggcgcga
tga

DBGET integrated database retrieval system