KEGG   Streptomyces griseus: SGR_2578Help
Entry
SGR_2578          CDS       T00691                                 

Definition
(GenBank) conserved hypothetical protein
Organism
sgr  Streptomyces griseus
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF1059
Motif
Other DBs
NCBI-ProteinID: BAG19407
Kitasato: SGR2578
UniProt: B1W2P3
Position
3039731..3039922
Genome map
AA seq 63 aa AA seqDB search
MTRKVADCRNYPSETNCTLAISGEEDEVVRAASEHAASVHGHEDSPALREQIRGMLEDEK
VGV
NT seq 192 nt NT seq  +upstreamnt  +downstreamnt
atgaccaggaaggtggcggactgccgcaactatccgagcgagacgaactgcaccctcgcc
atctccggtgaggaggacgaggtcgtccgggccgcgagcgagcacgccgcgtcggtccac
ggacacgaggacagtcccgcgctgcgggagcagatcaggggcatgctggaggacgagaag
gtgggcgtctga

DBGET integrated database retrieval system