KEGG   Streptomyces griseus: SGR_2593Help
Entry
SGR_2593          CDS       T00691                                 

Definition
(GenBank) putative glycine/serine hydroxymethyltransferase
  KO
K00600  glycine hydroxymethyltransferase [EC:2.1.2.1]
Organism
sgr  Streptomyces griseus
Pathway
sgr00260  Glycine, serine and threonine metabolism
sgr00460  Cyanoamino acid metabolism
sgr00630  Glyoxylate and dicarboxylate metabolism
sgr00670  One carbon pool by folate
sgr00680  Methane metabolism
sgr01100  Metabolic pathways
sgr01110  Biosynthesis of secondary metabolites
sgr01120  Microbial metabolism in diverse environments
sgr01130  Biosynthesis of antibiotics
sgr01200  Carbon metabolism
sgr01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:sgr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    SGR_2593
  09102 Energy metabolism
   00680 Methane metabolism
    SGR_2593
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SGR_2593
  09106 Metabolism of other amino acids
   00460 Cyanoamino acid metabolism
    SGR_2593
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    SGR_2593
Enzymes [BR:sgr01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.2  Hydroxymethyl-, formyl- and related transferases
    2.1.2.1  glycine hydroxymethyltransferase
     SGR_2593
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SHMT Aminotran_1_2 Beta_elim_lyase OKR_DC_1
Motif
Other DBs
NCBI-ProteinID: BAG19422
Kitasato: SGR2593
UniProt: B1W2Q8
Position
complement(3066392..3067738)
Genome map
AA seq 448 aa AA seqDB search
MLATEDFARHAARLLASEDEELVTAIACENHRQQNSLMLVASSSVTDPSVLACLATSSMN
VTAEGYPGARYHAGCEAIDPIEQLAIDRARALFGARYANVQAHSATTANYAVLSAVLNPG
DVVLGMRLNHGGHLTHGYSVAYSGTYFTPVNYGLDDQGRIDYDEVAALAAEHRPKLIICG
ATAYPRTVDFARFRAIADSVGALLMADISHIAGLVAAGLHPSPVDHAHITTTCTHKQLAG
PRGGIIMSGRDADTVLPATGRTLAKTLDRAVFPFFQGAPILPAIAAKARAFARAATDEYR
NTAQRILDNSAALAAELTALGHEVVTGGSDNHIVLLDLTRDNVSGMAAERALESIGIVVN
KNRVPGDTRPAAVTSGVRIGTNAVAQRGLGPREMRVCAGIIHTVLTTMRPVGDRDFTLDE
FTAAELRAEVDKLTAEFPLPRYEPSGRP
NT seq 1347 nt NT seq  +upstreamnt  +downstreamnt
atgctcgccaccgaagatttcgcccggcacgcggcgcggctgctggcgtcggaggacgaa
gaactcgtcaccgccatcgcctgcgagaaccaccgccagcagaactccctgatgctcgtc
gcctcctccagcgtcaccgacccctcggtcctcgcctgcctggcgacctcctcgatgaac
gtcaccgccgagggctaccccggcgcccgctaccacgccggctgcgaggccatcgacccg
atcgagcagctcgcgatcgaccgggcccgcgcgctgttcggcgcccggtacgccaatgtg
caggcccactcggcgaccaccgccaactatgcggtgctgtcagcggtcctgaacccgggc
gacgtcgtgctgggcatgcggctcaaccacggcgggcacctcacgcacggctacagcgtc
gcctactccggcacgtacttcaccccggtcaactacggcctggacgaccagggccgcatc
gactacgacgaggtcgccgccctcgccgccgaacaccgccccaagctgatcatctgcggt
gccaccgcctacccccgcaccgtcgacttcgcgcgcttccgggccatcgccgacagcgtc
ggcgccctgctgatggccgacatctcgcacatcgcgggcctggtggccgcgggcctgcac
cccagccccgtcgaccacgcgcacatcaccaccacctgcacccacaagcagctcgccggg
ccgcgcggcggcatcatcatgtccggccgggacgccgacaccgtcctgccggccaccggc
cggaccctggcgaagaccctggaccgtgccgtcttccccttcttccagggcgcgcccatc
ctgcccgccatcgcggcgaaggcacgcgccttcgcccgcgccgcgaccgacgagtaccgg
aacacggcccagcgcatcctggacaactcggccgccctggccgccgaactgaccgccctc
ggccacgaggtggtgaccgggggcagcgacaaccacatcgtgctgctcgacctgacccgc
gacaacgtcagcggcatggccgccgagcgggccctggagtcgatcggcatcgtcgtgaac
aagaaccgggtccccggcgacacccgccccgccgccgtcaccagcggcgtccgcatcggc
acgaacgccgtcgcccagcgcggcctcggcccccgcgagatgcgcgtctgcgccgggatc
atccacaccgtcctcaccaccatgcgccccgtcggcgaccgcgacttcaccctcgacgag
ttcaccgccgccgagctgcgcgccgaagtggacaaactgaccgccgagttcccgctgccc
cgctacgagccgagcggccggccgtga

DBGET integrated database retrieval system