KEGG   Streptomyces griseus: SGR_2606Help
Entry
SGR_2606          CDS       T00691                                 

Definition
(GenBank) hypothetical protein
Organism
sgr  Streptomyces griseus
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RDD
Motif
Other DBs
NCBI-ProteinID: BAG19435
Kitasato: SGR2606
UniProt: B1W2S1
Position
3086699..3087322
Genome map
AA seq 207 aa AA seqDB search
MRRAGSGAARPRPAAPTAAGRPSPGDALPRAAYPAYARSAYPAPTPRGQPRVPRGTGDMR
RYLAVGLDSYLCLLAVGLLVRSCLNSGGTGHAVALLVVQLVTLSFANQVLLTMAVRASAG
KLIMGVRVIRLPDAGRPGFRLLVRRWLYGLLWLPRQPWHRLRRSEADAPDRAPARRRAET
PEDLAGLRQVRRSDLRSYRAAMRGRTG
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
gtgcgccgtgccgggagcggagccgctcggccccggccggccgcgcccaccgcggcgggc
cggccgtcgcccggggacgcgcttccccgggcggcgtatccggcgtacgcccgctcggcg
tatcccgccccaacgccccgggggcagccgcgcgttccccggggcacgggcgacatgcgg
cgctacctggccgtcggcctcgacagctacctgtgcctgctggccgtcgggctcctcgtg
cggtcctgcctgaactcgggcgggacggggcacgcggtcgcgctgctggtcgtccagttg
gtcaccctgtcgttcgccaaccaggtgctgctgacgatggccgtccgggcgagcgccgga
aagctgatcatgggggtccgggtgatccggctgcccgacgccgggaggccgggattccgc
ctgctggtgcggcgctggctgtacgggctcctctggctgccgcgccagccctggcaccgg
ctccgccgctcggaggccgacgcccccgaccgggccccggcccgccgccgcgccgaaacg
cccgaggatctcgcggggctgcgccaggtccggcgcagcgatctgcggtcgtaccgggcg
gcgatgcgggggcgtacgggctga

DBGET integrated database retrieval system