KEGG   Streptomyces griseus: SGR_2609Help
Entry
SGR_2609          CDS       T00691                                 

Definition
(GenBank) hypothetical protein
Organism
sgr  Streptomyces griseus
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: BAG19438
Kitasato: SGR2609
UniProt: B1W2S4
Position
complement(3090931..3091380)
Genome map
AA seq 149 aa AA seqDB search
MSTEETSRFVRLRVEMVLEITDLDALTGTALESIAAEYGEPVAAVAGSDTAEERMHAEAT
VRADGAEALASLVDPFDLVSEVPGVELAQASWSSESVEYDPDAEGWDDADDGEEDLFLPL
DEGDEEGHGDAVAHNGKNDGEDGDPAQRV
NT seq 450 nt NT seq  +upstreamnt  +downstreamnt
atgagcacagaagagacatccaggtttgttcgacttcgcgtggagatggtgctggagatc
accgacctcgacgccctcaccggcaccgccctcgaatccatcgccgccgaatacggggag
cccgtcgcggcggtcgccgggagcgacaccgccgaggagcggatgcatgccgaggccacg
gtccgggcagacggagcggaggccctcgcctcgctggtcgaccccttcgacctggtcagc
gaggtgcccggggtcgagctggcccaggcctcctggagcagcgagagcgtcgagtacgac
cccgacgcggagggctgggacgacgcggacgacggcgaggaggacctcttcctgccgctg
gacgagggtgacgaggaggggcacggcgacgcggtcgcgcacaatgggaagaacgacggc
gaggacggtgaccccgcgcagcgggtgtga

DBGET integrated database retrieval system