KEGG   Streptomyces griseus: SGR_2610Help
Entry
SGR_2610          CDS       T00691                                 

Definition
(GenBank) hypothetical protein
Organism
sgr  Streptomyces griseus
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TAT_signal
Motif
Other DBs
NCBI-ProteinID: BAG19439
Kitasato: SGR2610
UniProt: B1W2S5
Position
3091488..3091802
Genome map
AA seq 104 aa AA seqDB search
MSVTRRTLLTATAAGTLLAALWFVPSANATGEHGDQGAPAAASARAAERPAGSPDDASGA
LLADTGPGPDTTPYLIGGTALLGLGAGFVTYSVRRSGSGARPAL
NT seq 315 nt NT seq  +upstreamnt  +downstreamnt
gtgtccgtcactcgtcgcacactgctgaccgccaccgccgcaggcacgctgctggccgct
ctctggttcgtcccgtcggccaacgcgaccggtgagcacggcgatcagggcgccccggcc
gccgcgtccgcccgagccgccgaacggcccgccgggagccccgacgacgcctccggcgcg
ctcctcgcggacaccgggcccggcccggacacgaccccgtatctcatcggcggcacagcc
ctgttgggcctcggcgcaggcttcgtcacctactccgtgcgccgctccggatccggggcg
cgcccggcgctctga

DBGET integrated database retrieval system