KEGG   Streptomyces griseus: SGR_2611Help
Entry
SGR_2611          CDS       T00691                                 

Gene name
hutH
Definition
(GenBank) histidine ammonia-lyase
  KO
K01745  histidine ammonia-lyase [EC:4.3.1.3]
Organism
sgr  Streptomyces griseus
Pathway
sgr00340  Histidine metabolism
sgr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sgr00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00340 Histidine metabolism
    SGR_2611 (hutH)
Enzymes [BR:sgr01000]
 4. Lyases
  4.3  Carbon-nitrogen lyases
   4.3.1  Ammonia-lyases
    4.3.1.3  histidine ammonia-lyase
     SGR_2611 (hutH)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Lyase_aromatic PALP
Motif
Other DBs
NCBI-ProteinID: BAG19440
Kitasato: SGR2611
UniProt: B1W2S6
Position
complement(3091872..3093422)
Genome map
AA seq 516 aa AA seqDB search
MDMHTVVVGTSGTTAEDVVAVARHGARVELSAAAVEALAAARLIVDALAAKPEPVYGVST
GFGALASRHIGTELRAQLQRNIVRSHAAGMGPRVEREVVRALMFLRLKTVASGHTGVRPE
VAQTMADVLNAGITPVVHEYGSLGCSGDLAPLSHCALTLMGEGEAEGPDGTVRPAGELLA
AHGIAPVELREKEGLALLNGTDGMLGMLVMALADLRNLYTSADITAALSLEALLGTDKVL
APELHAIRPHPGQGVSADNMSRVLAGSGLTGHHQDDAPRVQDAYSVRCAPQVNGAGRDTL
DHAALVAGRELASSVDNPVVLPDGRVESNGNFHGAPVAYVLDFLAIVAADLGSICERRTD
RLLDKNRSHGLPPFLADDAGVDSGLMIAQYTQAALVSEMKRLAVPASADSIPSSAMQEDH
VSMGWSAARKLRTAVDNLARIVAVELYAATRAIELRAAEGLTPAPASEAVVAALRAAGAE
GPGPDRFLAPDLAAADTFVREGRLVAAVEPVTGPLA
NT seq 1551 nt NT seq  +upstreamnt  +downstreamnt
atggatatgcacactgttgtggtggggacgtccggaaccaccgccgaggacgtcgtcgcc
gtggcccgccacggcgcccgggtcgagctctccgccgccgccgtggaagccctggccgcc
gcccgtctcatcgtggacgccctcgccgccaaacccgagccggtctacggtgtctccacc
ggcttcggcgccctcgccagccgccacatcggcacggaactgcgggcgcagctccagcgc
aacatcgtccgctcgcacgcggccggcatgggcccgcgcgtcgagcgcgaggtcgtccgc
gcgctgatgttcctccggctgaagacggtcgcctcggggcacaccggcgtacgccccgag
gtcgcgcagaccatggccgacgtgctgaacgcgggcatcacgcccgtcgtccacgaatac
ggctcgctcggctgctccggcgacctcgccccgctctcgcactgcgcgctcaccctgatg
ggcgagggcgaagcggaggggcccgacggcaccgtccgcccggccggggaactcctcgcc
gcgcacggcatcgccccggtcgagctccgcgagaaggagggcctggccctcctcaacggc
accgacggcatgctcggcatgctggtcatggccctcgccgacctgaggaacctctacacc
tcggccgacatcaccgcggccctgtccctggaggcgctcctcggtacggacaaggtcctc
gcccccgagctgcacgccatccgcccgcaccccggacagggcgtcagcgccgacaacatg
tcgcgggtgctggccggttcggggctgacgggccatcaccaggacgacgccccccgggtc
caggacgcctattcggtgcgctgcgcgccccaggtcaacggcgcgggccgcgacaccctc
gaccacgccgccctcgtcgcgggccgcgaactggcctcctccgtcgacaatcccgtggtc
ctccccgacggacgcgtcgagtccaacgggaacttccacggggcgcccgtcgcgtacgtc
ctggacttcctcgcgatcgtcgccgccgacctcggctcgatctgcgagcgccgcaccgac
cggctgctcgacaagaaccgctcgcacggcctgccgccgttcctcgcggacgacgccggg
gtcgactcgggcctgatgatcgcccagtacacccaggccgccctggtcagcgagatgaag
cggctcgcggtccccgcctccgccgactccatcccgtcctccgcgatgcaggaggaccac
gtctccatgggatggtccgccgcccgcaaactccgtacggccgtggacaacctggcccgg
atcgtcgccgtcgagctgtacgcggcgacccgcgccatcgagctccgcgccgccgagggc
ctcaccccggcccccgcctcggaggccgtcgtggccgcgctgcgggccgccggcgccgag
ggcccgggcccggaccgcttcctcgcgccggacctggccgccgccgacacgttcgtacgg
gaggggcgcctggtcgcggccgtggagcccgtcacggggccgctggcctga

DBGET integrated database retrieval system