KEGG   Streptomyces griseus: SGR_2627Help
Entry
SGR_2627          CDS       T00691                                 

Definition
(GenBank) putative phosphomannomutase
  KO
K01840  phosphomannomutase [EC:5.4.2.8]
Organism
sgr  Streptomyces griseus
Pathway
sgr00051  Fructose and mannose metabolism
sgr00520  Amino sugar and nucleotide sugar metabolism
sgr01100  Metabolic pathways
sgr01110  Biosynthesis of secondary metabolites
sgr01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:sgr00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    SGR_2627
   00520 Amino sugar and nucleotide sugar metabolism
    SGR_2627
Enzymes [BR:sgr01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.8  phosphomannomutase
     SGR_2627
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PGM_PMM_I PGM_PMM_II PGM_PMM_III PGM_PMM_IV
Motif
Other DBs
NCBI-ProteinID: BAG19456
Kitasato: SGR2627
UniProt: B1W2U2
Position
3108715..3110358
Genome map
AA seq 547 aa AA seqDB search
MQHDLIAQAHTWLAEDPDPETRAELGAIVEAGDTQELAARFAGTLQFGTAGLRGELGAGP
MRMNRSVVIRAAAGLAAYLKAQGQEGGLVVIGYDARYKSAEFARDTAAVMTGAGLRAAVL
PRPLPTPVLAYAIRHLGAVAGVEVTASHNPPRDNGYKVYLGDGSQIVPPADGEIAAAIDA
VGPLAGVVRPEDGWETLGDEVLAAYLARTDAVLAPDSPRTARTVYTALHGVGTSVLTAAF
ARAGFPEPVLVAEQAEPDPAFPTVAFPNPEEPGAMDLAFATARRAAPDLIIANDPDADRC
AVAVPDSSVEGGWRMLRGDEVGALLAAHLVERGATGVFAESIVSSSLLGRIAEKAGLGYE
ETLTGFKWIARVDGLRYGYEEALGYCVDPEGVRDKDGITAALLVAELASVLKEQGGRTLL
DLLDDLALAHGLHATDQLSVRVEDLSVIADAMTRLRERPPTALAGLAVTSAEDLSQGTDR
LPPTDGLRYRLEGARVIVRPSGTEPKLKCYLEVVVPVADAAGLPAARARGAELLAGIKRD
LATAAGI
NT seq 1644 nt NT seq  +upstreamnt  +downstreamnt
gtgcagcacgacctcatcgcgcaggcccatacctggctggccgaggatcccgaccccgag
acgcgcgcggagctgggcgcgatcgtcgaggcgggcgacacccaggaactcgccgcccgc
ttcgcgggcacgctccagttcggcaccgccggcctgcgcggggagctcggggccgggccg
atgcggatgaaccggtccgtggtgatccgggcggcggcggggctcgccgcctacctgaag
gcccaggggcaggagggcgggctcgtcgtcatcggctacgacgcccgctacaagtcggcg
gagttcgcgcgcgacacggcggcggtgatgacgggcgccggactgcgtgccgccgtgctc
ccccgcccgctccccacccccgtactggcgtacgccataaggcacctgggcgccgtcgcc
ggcgtcgaggtcaccgccagccacaacccgccccgcgacaacggctacaaggtctacctc
ggcgacggctcccagatcgtgcccccggcggacggcgagatcgcggccgccatcgacgcg
gtcggcccgctggcgggcgtcgtacgccccgaggacggctgggagaccctcggcgacgag
gtcctggccgcctacctcgcccgtacggacgcggtcctggcccccgacagcccccgtacc
gcgcgcacggtctacacggccctgcacggcgtcggcacctccgtgctgaccgccgcgttc
gcccgggccggtttcccggagccggtcctcgtcgccgagcaggcggagcccgaccccgcg
ttccccaccgtggccttccccaacccggaggagcccggcgcgatggatctcgccttcgcc
accgcacgccgggcggcaccggacctgatcatcgccaacgacccggacgcggaccgctgc
gccgtggccgtgcccgacagctccgtcgagggcggctggcggatgctgcgcggcgacgag
gtgggcgcgctgctcgccgcgcacctggtggagcggggcgcgacgggggtcttcgccgag
tcgatcgtctcgtcgtcgctgctgggccggatcgcggagaaggcgggcctgggctacgag
gagacgctgacgggcttcaagtggatcgcccgggtggacggcctgcggtacggctacgag
gaggcgctcggctactgcgtcgaccccgagggcgtccgcgacaaggacggcatcaccgcc
gccctgctcgtcgccgagctcgcctccgtactcaaggagcaggggggccgtacgctcctg
gacctgctggacgacctggcgctcgcgcacggcctgcacgccaccgaccagctctcggtg
cgggtggaggacctctccgtcatcgcggacgccatgacccggctccgcgagcggccgccg
accgccctggccggtctcgcggtcacctcggccgaggacctgtcgcagggcacggaccgg
ctgccgcccaccgacgggctgcgctaccggctggagggggcccgggtgatcgtccgcccg
agcggcaccgagccgaagctgaagtgctacctggaggtcgtcgtcccggtggcggacgcg
gccgggctgcccgcagcgcgggcccggggcgccgaactgctcgccgggatcaagcgggac
ctggcgacggccgcgggcatctga

DBGET integrated database retrieval system