KEGG   Streptomyces griseus: SGR_2634Help
Entry
SGR_2634          CDS       T00691                                 

Definition
(GenBank) putative RNA polymerase ECF-subfamily sigma factor
Organism
sgr  Streptomyces griseus
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sigma70_r4_2 Sigma70_r4 Sigma70_r2 GerE HTH_23 Sigma70_ECF
Motif
Other DBs
NCBI-ProteinID: BAG19463
Kitasato: SGR2634
UniProt: B1W2U9
Position
complement(3116016..3116624)
Genome map
AA seq 202 aa AA seqDB search
MAVVDAPKAAAGAYGEATGDRGTRTENADAEAAFTAYVQERRASLYATAYHLTGDRFEAE
DLLQSALFSTYRAWDRISDKAAVGGYLRRTMTNLHISAWRRRKLNEYPTEELPETVGDTD
AMRGTELRAVLWQALARLPELQRTMLVLRYYEGRTDPEIASILDISVGTVKSSIWRSLRR
LREDEVLSFGRDEQESFGELVA
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atggcggtggtcgacgcacccaaggcggcggccggcgcgtacggggaggccacgggggat
cgcggaacccggacggagaacgcggacgccgaagcggcgttcacggcctacgtccaggag
cgacgggcctccctgtacgccaccgcctaccacctgaccggtgaccggttcgaggccgag
gacctgttgcagagcgccctcttctcgacgtaccgggcgtgggaccggatcagcgacaag
gcggcggtcggcggctatctgcgccgcaccatgaccaatctgcacatcagcgcctggcgc
aggcgcaagctcaacgaatacccgaccgaggagctgccggagacggtgggcgacacggac
gcgatgcgcggcacggagctgcgggcggtgctgtggcaggcgctcgcccggctgcccgaa
ctccagcgcacgatgctggtcctgcggtactacgagggccgcaccgacccggagatcgcg
tcgatcctcgacatcagtgtcggcacggtgaagtccagcatctggcgctccctgcgccgg
ctgcgcgaggacgaggtcctcagcttcggacgtgacgagcaggagtccttcggcgagttg
gtggcctga

DBGET integrated database retrieval system