KEGG   Streptomyces griseus: SGR_2637Help
Entry
SGR_2637          CDS       T00691                                 

Definition
(GenBank) putative lipoprotein
Organism
sgr  Streptomyces griseus
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Germane LPAM_2
Motif
Other DBs
NCBI-ProteinID: BAG19466
Kitasato: SGR2637
UniProt: B1W2V2
Position
3119205..3119837
Genome map
AA seq 210 aa AA seqDB search
MKRGDVTYRRGPLRRRTAASLAAVLATAALVSGCGIRTTSVPVDAGAAPSRVPCRLSASD
AAGRSPDGASTTVYLVCTSQLVTAERAVADATDTDPLVVARALLKEVQQAPPANERRAGF
TTAVPAGLRVLPARDGDPAGAVRLSSQPEDLSAEALAQLVCTYAESETLVTEGAVVLGGP
GDYPPRGRLCTSQTKSRPGDLTTPDSIRLD
NT seq 633 nt NT seq  +upstreamnt  +downstreamnt
gtgaagcgcggcgatgtcacgtaccggcggggcccgctccggcggcgtacggcagcctcg
ctggcggccgtgctggcgaccgcggcgctggtctccgggtgcgggatccgtacgacctcg
gtgccggtggacgcgggagccgcgccctcccgggtcccgtgccggctgtccgcctcggac
gccgccggccggtcgccggacggcgcgagcaccacggtgtacctggtgtgcacctcgcag
ctggtcaccgcggaacgtgcggtggcggacgccacggacaccgaccccctggtggtggcc
cgggcgctgctcaaggaggtccagcaggcgcccccggcgaacgagcggcgggccggcttc
accaccgcggttccggcggggctgcgggtgctcccggcccgggacggcgatccggcgggc
gccgtgcgcctcagcagccagccggaggacctgtcggcggaggcgctggcccagctggtg
tgcacgtacgcggagagcgagacgctggtcaccgaaggggcggtggtgctgggcgggccc
ggggactacccgccgcgcggccgtctgtgcacgtcgcagacgaagtcccggccgggcgac
ctgaccacaccggacagcatccggctggactga

DBGET integrated database retrieval system