KEGG   Streptomyces griseus: SGR_2649Help
Entry
SGR_2649          CDS       T00691                                 

Definition
(GenBank) putative thymidine phosphorylase
  KO
K00758  thymidine phosphorylase [EC:2.4.2.4]
Organism
sgr  Streptomyces griseus
Pathway
sgr00240  Pyrimidine metabolism
sgr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sgr00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    SGR_2649
Enzymes [BR:sgr01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     SGR_2649
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glycos_transf_3 PYNP_C Glycos_trans_3N Biotin_lipoyl DUF2254 DUF1039 TMP_2
Motif
Other DBs
NCBI-ProteinID: BAG19478
Kitasato: SGR2649
UniProt: B1W2W4
Position
complement(3132028..3133305)
Genome map
AA seq 425 aa AA seqDB search
MDAISVIRTKRDRGELTPEQIDWVIDAYTRGEVADEQMSALAMAILLNGMNRTEIARWTA
AMIASGERMNFRALSRPTTDKHSTGGVGDKITLPLAPLVAACGAAVPQLSGRGLGHTGGT
LDKLESIPGWRAHISNEEMLNVLDSTGAVICAAGDGLAPADKKLYALRDVTGTVEAIPLI
ASSIMSKKIAEGTGALVLDVKVGSGAFMKTIEDARELASTMVALGTDSGVRTVALLTDMS
TPLGLTAGNALEVRESVEVLAGGGPQDVVDLTLALAREMLDAAGLKDADPEKALADGSAM
DVWRRMISAQGGDPDATLPTAREQHVVTAPASGVLTRLDAYDVGVAAWRLGAGRARKEDP
VQAGAGVELHAKPGDTVTEGQPLMTLHTDTPEKFDYALKALPEAYDIAPAGTSFAPLPVV
RERIA
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atggacgccatctccgtcatccgcaccaagcgggaccgaggcgaactgacccccgagcag
atcgactgggtcatcgacgcctacacccgcggcgaggtcgccgacgagcagatgtccgcc
ctcgccatggcgatcctgctcaacggcatgaaccgcaccgagatcgcccgctggaccgcc
gcgatgatcgcctcgggcgagcggatgaacttccgagcgctctcccggcccaccaccgac
aagcactccaccggcggcgtcggcgacaagatcaccctgccgctcgccccgctggtcgcc
gcctgcggcgcggccgtgccgcagctcagcggacgcggcctcggccacaccggcggcacc
ctggacaagctggagtccatccccggctggcgggcccatatctccaacgaggagatgctg
aacgtcctggactccaccggcgcggtcatctgcgcggcgggcgacggactcgcccccgcc
gacaagaagctgtacgcgctgcgcgatgtcaccggcaccgtcgaggcgatcccgctgatc
gccagctcgatcatgtccaagaagatcgccgagggcaccggggcgctggtcctggacgtc
aaggtcggctccggcgccttcatgaagaccatcgaggacgcccgcgaactggcctccacc
atggtcgcgctcggcaccgacagcggggtgcgcacggtcgccctgctcaccgacatgtcg
accccgctcggcctcaccgcgggcaacgccctggaggtccgcgagtccgtcgaggtcctc
gccggcggaggcccccaggacgtcgtcgacctgaccctcgccctggcccgcgagatgctg
gacgcggcgggcctcaaggacgccgacccggagaaggccctggccgacggctccgcgatg
gacgtctggcgccggatgatctccgcccagggcggcgacccggacgccacgctccccacc
gcgcgcgagcagcacgtggtcaccgcccccgcctccggcgtcctgacccggctggacgcc
tacgacgtcggcgtcgccgcctggcgcctcggcgcgggccgcgcccgcaaggaggacccg
gtgcaggcgggcgcgggcgtcgaactccacgccaagcccggcgacacggtcaccgagggc
cagcccctgatgacgctgcacacggacaccccggagaagttcgactacgccctcaaggcc
ctgccggaggcgtacgacatcgccccggccggcacgtcgttcgcgccgctgccggtggtg
cgggaacgtatcgcctga

DBGET integrated database retrieval system