KEGG   Streptomyces griseus: SGR_2651Help
Entry
SGR_2651          CDS       T00691                                 

Definition
(GenBank) putative sugar ABC transporter permease protein
  KO
K02057  simple sugar transport system permease protein
Organism
sgr  Streptomyces griseus
Module
sgr_M00221  Putative simple sugar transport system
Brite
Transporters [BR:sgr02000]
 ABC Transporters, Prokaryotic Type
  Saccharide, polyol, and lipid transporters
   Putative simple sugar transporter [MD:M00221]
    SGR_2651
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_2
Motif
Other DBs
NCBI-ProteinID: BAG19480
Kitasato: SGR2651
UniProt: B1W2W6
Position
complement(3133846..3135108)
Genome map
AA seq 420 aa AA seqDB search
MSTSTSIAARPTPLKGGRRKLSLPVVLLIIAGALALVSLVRLISGANDVTSVGQVAGALE
LAVPIGLAGLGGLWAERAGVVNIGLEGMMVLGTWFGAWAGFQWGPWVGVLFGVLGGCLGG
LLHAVITVTFGVNHIVSGVAINILAVGVTRYLSNFAFDGIQGGSSKQSPRIDPIDKITIP
GLSDWLQDLQQQHWFLISDIAGILGGLVTGLSLLTVVALLLIPATWWILWRTPFGLRLRS
CGESPVAAETLGVNVYKYKYIAVTVSGGLAGLGGAFLAIVATGIYQEGQTGGRGYIGLAA
MIFGNWMPGGMALGAGLFGFTDSLKLRGGAENVHAMLLLLAILLVIAVFWQLYRKKYVAA
AISAVVSALLFTWYLLTDQVPSQFVDAAPYVTTLLVLSLSAQRLRMPKADGVPYRKGEGK
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
gtgagcacgagcacgtccatcgccgcacggcccacccccctcaagggcggccgccgcaag
ctctccctgcccgtcgtcctcctgatcatcgcgggtgcgctcgccctggtctccctcgtg
cgcctcatcagcggcgccaacgacgtcacctcggtcggccaggtcgccggcgccctggaa
ctggccgtcccgatcggcctcgccggactcggcggcctgtgggccgagcgcgcgggcgtc
gtcaacatcggcctcgaaggcatgatggtcctgggcacctggttcggcgcctgggccgga
ttccagtggggtccctgggtgggcgtcctcttcggcgtcctcggcggctgcctcggcggc
ctgctgcacgcggtcatcaccgtcaccttcggcgtgaaccacatcgtctccggtgtggcc
atcaacatcctcgccgtcggcgtcacccgctacctctccaacttcgccttcgacggcatc
cagggcggctcctccaagcagtccccgcgcatcgatccgatcgacaagatcaccattccg
ggcctctcggactggttgcaggacctgcaacaacagcactggttcctgatctccgacatc
gcgggcatcctcggcggcctggtcaccggactctccctgctgaccgtcgtcgccctgctg
ctgatccccgccacctggtggatcctgtggcgcaccccgttcgggctgcggctgcgctcc
tgcggcgagtccccggtggccgccgagaccctcggcgtcaacgtgtacaagtacaagtac
atcgccgtcaccgtctccggcggtctggcgggcctcggcggagcgttcctcgcgatcgtc
gccaccggcatctaccaggagggccagaccggcggtcgcggctacatcggtctcgccgcc
atgatcttcggcaactggatgccgggcggcatggcgctgggcgccggactcttcggcttc
accgacagcctcaagctgcgcggcggcgcggagaacgtccacgcgatgctgctcctgctg
gcgatcctgctggtcatcgcggtgttctggcagctgtaccggaagaagtacgtcgccgcg
gcgatctcggcggtcgtctcggcgctgctgttcacctggtacctcctgaccgaccaggtg
ccgagccagttcgtcgacgccgccccgtacgtcacgacgctgctggtcctctcgctctcc
gcgcaacggctgcggatgcccaaggcggacggcgtgccgtaccgcaagggcgagggcaag
tga

DBGET integrated database retrieval system