KEGG   Streptomyces griseus: SGR_2653Help
Entry
SGR_2653          CDS       T00691                                 

Definition
(GenBank) putative sugar ABC transporter ATP-binding protein
  KO
K02056  simple sugar transport system ATP-binding protein [EC:3.6.3.17]
Organism
sgr  Streptomyces griseus
Module
sgr_M00221  Putative simple sugar transport system
Brite
KEGG Orthology (KO) [BR:sgr00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:sgr02000]
    SGR_2653
Enzymes [BR:sgr01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.3  Acting on acid anhydrides to catalyse transmembrane movement of substances
    3.6.3.17  monosaccharide-transporting ATPase
     SGR_2653
Transporters [BR:sgr02000]
 ABC Transporters, Prokaryotic Type
  Saccharide, polyol, and lipid transporters
   Putative simple sugar transporter [MD:M00221]
    SGR_2653
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 AAA_29 AAA_15 RsgA_GTPase SMC_N AAA_27 AAA_23 MMR_HSR1 MukB AAA_22
Motif
Other DBs
NCBI-ProteinID: BAG19482
Kitasato: SGR2653
UniProt: B1W2W8
Position
complement(3136220..3137746)
Genome map
AA seq 508 aa AA seqDB search
MHGITKRFPGVVANHDIDITIGKGTVHALVGENGAGKSTLMKILYGMQKPDEGTIAINGE
QVSFSNPGDAIERGIGMVHQHFMLADNFTVLENVVLGGEKLYGIGSGARKKIKEISDAYG
LGIRPDALVEDLGVADRQRVEILKVLYRGARILILDEPTAVLVPQEVDALFANLRELKAE
GLTVIFISHKLGEVLSVADDITVIRRGTTVGTADPASTTTKQLAELMVGSELPSPETRES
TVTDVPMLRVQDLALTVTDPDGTVRDVLAGIDLTIHQGEVLGIAGVEGNGQTELIEALIG
MRDPDGGVITLDQDDISHVPTRKRRESGIGYIPEDRHRHGVLLDAPLWENRILGHVTEKP
NSRGWLLDNKAARADTERIVREYDVRTPGIEVTAASLSGGNQQKLIVGREMSHAPKLLIA
AHPTRGVDVGAQAQIWDQIREARREGLAVLLISADLDELIGLSDTLRVMYRGRLVADADP
ATITPEELGSAMTGAATGHLESPEDEAR
NT seq 1527 nt NT seq  +upstreamnt  +downstreamnt
ctgcacggcatcaccaagcgcttccccggcgtcgtcgccaaccacgacatcgacatcacg
atcggcaagggcacggtccatgccctcgtcggcgagaacggcgccggcaagtccaccctg
atgaagatcctctacggcatgcagaagccggacgagggcaccatcgcgatcaacggcgag
caggtctcgttctccaacccgggtgacgccatcgagcggggcatcggcatggtgcaccag
cacttcatgctcgccgacaacttcaccgtcctggagaacgtcgtcctgggcggcgagaag
ctgtacggcatcggctccggcgcccggaagaagatcaaggagatctccgacgcgtacggc
ctgggcatccggcccgacgcgctcgtggaggacctcggggtcgccgaccggcagcgcgtg
gagatcctcaaggtcctctaccggggcgcccgcatcctgatcctggacgagccgaccgcg
gtcctcgtgccgcaggaggtcgacgcgctcttcgccaacctgcgcgagctcaaggccgag
ggcctgaccgtcatcttcatctcgcacaagctgggcgaggtgctctccgtcgccgacgac
atcacggtgatccgccgcggcacgaccgtgggcaccgccgacccggcgtccaccacgacc
aagcagctcgccgagctgatggtcggcagcgagctgccctcgccggagacccgcgagtcc
accgtcaccgacgtgcccatgctgcgcgtccaggacctcgcgctcacggtcaccgacccc
gacggcaccgtccgcgacgtgctcgccggcatcgacctcaccatccaccagggcgaggtc
ctcggcatcgccggggtggagggcaacgggcagaccgagctgatcgaggccctgatcggc
atgcgcgacccggacggcggggtgatcaccctcgaccaggacgacatcagccacgtcccc
acccgcaagcggcgcgagtcgggcatcggctacatccccgaggaccgccaccgccacggc
gtcctgctggacgccccgctgtgggagaaccgcatcctcggccacgtcaccgagaagccc
aacagccgcggctggctgctggacaacaaggcggcccgcgccgacaccgagcggatcgtg
cgcgagtacgacgtgcgcacccccggcatcgaggtcaccgcggcctccctctccggcggc
aaccagcagaagctgatcgtcggccgcgagatgagccacgcacccaagctcctgatcgcc
gcccaccccacccgcggtgtggacgtcggcgcccaggcgcagatctgggaccagatccgc
gaggcccgccgcgagggcctcgccgtcctgctgatctcggccgacctggacgagctgatc
gggctctccgacaccctgcgcgtcatgtaccgcggccggctggtcgccgacgccgacccg
gccaccatcaccccggaggaactgggctcggccatgaccggcgccgccaccggtcacctc
gaaagcccggaggacgaggcccgatga

DBGET integrated database retrieval system