KEGG   Streptomyces griseus: SGR_4757
Entry
SGR_4757          CDS       T00691                                 

Definition
(GenBank) putative hydroxymethylglutaryl-CoA lyase
  KO
K01640  hydroxymethylglutaryl-CoA lyase [EC:4.1.3.4]
Organism
sgr  Streptomyces griseus
Pathway
sgr00072  Synthesis and degradation of ketone bodies
sgr00280  Valine, leucine and isoleucine degradation
sgr00281  Geraniol degradation
sgr00650  Butanoate metabolism
sgr01100  Metabolic pathways
sgr01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sgr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    SGR_4757
  09103 Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    SGR_4757
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SGR_4757
  09109 Metabolism of terpenoids and polyketides
   00281 Geraniol degradation
    SGR_4757
Enzymes [BR:sgr01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.4  hydroxymethylglutaryl-CoA lyase
     SGR_4757
SSDB
Motif
Pfam: HMGL-like
Other DBs
NCBI-ProteinID: BAG21586
Kitasato: SGR4757
UniProt: B1VW75
Position
complement(5590232..5591203)
AA seq 323 aa
MTTRALPMRVPAPGLPARVRIHEVGPRDGLQNEKGTVPTEVKAQFIRRLAVAGLTTIEAT
SFVHPKWVPQLADAEALFPLVGDIADVGDVSLPVLVPNERGLDRALALGARSIAVFGSAT
ETFAARNLNRTVDESLAMFAPVVARAKAEKASVRGYLSMCFGDPWEGAVPVAQVVRVAKA
LMDLGCDELSLGDTIGVATPGHVTALLTALNEAGVATPAMGVHFHDTYGQALSNTLAALR
HGVSTVDASAGGLGGCPYAESATGNLATEDLVWMLDGLGIETGVDLDELTATSVWLAGHL
GRPSPSRTVRALTPSTSSPSHKE
NT seq 972 nt   +upstreamnt  +downstreamnt
atgacgacacgtgcgctgcccatgcgggtcccggccccgggcctccccgcccgggtcagg
atccacgaggtggggccgcgcgacggcctccagaacgagaagggcaccgtcccgacggag
gtgaaggctcagttcatccgccgactggcggtggccggcctgaccaccatcgaggcgacg
agcttcgtgcatccgaagtgggtgccccaactggcagacgcggaagccctgttccccctc
gtcggggacatcgcggacgtgggcgacgtctcgctccccgtcctcgtgccgaacgaacgc
ggactggaccgggccctggcgctcggggcccggtcgatcgcggtgttcggctcggcgacg
gagacgttcgccgcacgcaatctgaaccggaccgtggacgagtcgctggcgatgttcgcg
ccggtggtggcccgtgcgaaggcggagaaggcctctgtgcgcggctatctgtcgatgtgc
ttcggcgacccctgggaaggcgcggtgccggtggcgcaggtggtcagggtcgcgaaggcg
ctgatggacctgggctgcgacgagctgtcgctgggcgacacgatcggagtggcgacgccg
ggccacgtcacagcgctgctgaccgccctgaacgaggcgggcgtcgcgacccccgcgatg
ggcgtccacttccacgacacgtacggccaggcgctgtccaacaccctcgcggcgctccgg
cacggggtgagcacggtcgacgcctcggcgggcggcctgggcggctgcccgtacgccgag
agcgccacgggaaacctcgccaccgaggacctggtctggatgctcgacggcctcggcatc
gagacgggcgtcgacctcgacgagttgaccgccaccagcgtctggctggccggacacctg
ggccggccgagcccgtcccgcacggtccgcgccctcaccccctccacttcctccccctcc
cacaaggagtga

DBGET integrated database retrieval system