KEGG   Streptomyces griseus: SGR_4879Help
Entry
SGR_4879          CDS       T00691                                 

Definition
(GenBank) putative 4-alpha-glucanotransferase
  KO
K00705  4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
sgr  Streptomyces griseus
Pathway
sgr00500  Starch and sucrose metabolism
sgr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sgr00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    SGR_4879
Enzymes [BR:sgr01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     SGR_4879
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_77 DUF4272
Motif
Other DBs
NCBI-ProteinID: BAG21708
Kitasato: SGR4879
UniProt: B1VX62
Position
5748763..5751282
Genome map
AA seq 839 aa AA seqDB search
MGLSRLAALHGVATSYSPSPDVTVSVPDDTVIAVLAALGVDAGTPADVRKCLVAAESRSR
LLPPTVVVWAGEPLPPSLAGLPSGSTVTVEPEPADTPGPSGRPPAPLSMRARASAPAPPV
PPPPGAAAAPLTPPGTAATTTAPVAAAAAAPPATEAAAPAAVAVPPVTQAGNADSAPAVT
PVAGTATASASPAASASASASPSATASAPATASAPATASAPATALPSASAPHTHPRRADE
APVVPAAVPAWWIPPPPGVHRVHVRTPDHRRATATLVVAPARVPQPPERSHGFLVQLYSL
LSARSWGMGDLGDLADLAAWAGRTLGSGFVQVNPLHAAVPGRPTDPSPYRPSSRRFPDPV
HLRVESVPEYGHVRDRAALDDLRQGADALSEAVLNKGALIDRDAVWELKRQALELVVEVP
LTPGRRAAYCDFLAEQGQALEDHALWCALAEVHGPDWRTWPEALRDPRSSGTARARSELL
DRVDFHCRLAWLTADQLAAAQRAAEEAGMSVGIVHDLAVGVHPAGADTWAQQEAFAHGMS
VGAPPDAFNARGQDWGLPPWRPDTLAATGYAAYRGLLRGLLAGAGALRIDHVMGLFRLWW
VPEGSPPTDGTYVAHDAEAMLAVLVLEAHRAGTVVVGEDLGTVAPGVREALARRGVLGTS
VLWFERDWDGDGRPIAPEKWRRDCLATATTHDLPSTAARLTGDHVTLRHRLGLLTRSLEE
ELTADLTDTAEWLALLARLRMLPEGDGDEEAAVRAVHRFLLRTPARMTGVWLPDTVGDRR
PQNLPGTWDQYPNWRLPIADAEGHPVTLEEITASPRLHALMDVLRPRKPHTAPPGERRP
NT seq 2520 nt NT seq  +upstreamnt  +downstreamnt
atgggcttgtcccggctcgccgcactgcacggtgtcgccacctcctactccccgtcgccg
gatgtcacggtgtccgtccccgacgacacggtcatcgccgtgctcgccgcgctgggcgtc
gacgccggcactccggcggacgtacggaagtgcctcgtcgccgcggagtcccgctcgcgc
ctgctgccgccgaccgtggtggtctgggccggcgagcccctgccgccctccctcgccggg
ctgccctccggctcgaccgtcacggtcgagccggagccggccgacaccccgggcccctcg
ggccgcccgcccgccccgctgagcatgcgggcccgggcgtcggcccccgccccgcccgtg
ccgccgcccccgggagccgctgccgcgcccctgacgccccccgggaccgccgccaccacc
accgcgcccgtcgccgccgcagccgccgcgccgcccgccacggaagccgccgcgcccgcc
gcagtcgccgtgccgcccgtgacgcaggcgggaaacgcggactccgccccggccgtgacg
cccgtcgcggggaccgccaccgcatcggcgtcccccgccgcgtccgcgtccgcgtccgcg
tcaccgtccgccaccgcgtccgcgcccgccaccgcgtccgcgcccgccaccgcgtccgcg
cccgccaccgccctcccgtcggcatccgcgccgcacacgcacccgcgtcgcgccgacgag
gcgcccgtggtcccggcggccgttcccgcctggtggatcccgccgccccccggcgtccac
cgcgtccacgtccgtacgccggaccaccgccgcgccacggccaccctcgtcgtcgccccg
gcccgcgtcccccagccgcccgagcgctcccacggcttcctggtccagctctactccctg
ctctccgcccgctcctggggcatgggcgacctcggtgacctggccgacctcgccgcctgg
gccggtcggaccctcggctccgggttcgtccaggtcaacccgttgcacgcggctgttccc
gggcggccgaccgacccctccccctaccgcccgtcctcgcgccggttccccgatccggtg
cacctgcgcgtcgagtcggtccccgaatacggccacgtccgcgaccgggccgccctggac
gacctccggcagggcgccgacgccctcagcgaggccgtgctgaacaagggcgccctgatc
gaccgggacgccgtctgggagctgaagcggcaggccctggagctggtcgtcgaggtgccg
ctcacccccggccgccgcgccgcctactgcgacttcctggccgagcagggccaggcgctg
gaggaccacgccctgtggtgcgcgctcgccgaggtgcacggccccgactggcgcacctgg
cccgaggccctgcgcgacccccgctcgtccgggaccgcccgcgcccgctccgaactgctc
gaccgggtcgacttccactgccgcctcgcctggctgaccgccgaccagctcgccgccgcc
cagcgcgccgccgaggaagcagggatgagcgtcgggatcgtccacgacctcgccgtcggc
gtgcacccggccggcgccgacacctgggcccagcaggaggccttcgcccacggcatgtcc
gtcggcgcgccgcccgacgccttcaacgcgcgcggccaggactggggcctgccgccctgg
cgccccgacaccctcgccgccaccggctacgccgcctaccggggcctgctgcgcggactg
ctggccggcgccggggccctgcgcatcgaccacgtcatgggcctgttccggctctggtgg
gtgcccgagggcagcccgcccaccgacggcacgtacgtcgcccacgacgccgaggcgatg
ctcgccgtcctcgtcctggaggcccaccgggccggcaccgtcgtcgtcggcgaggacctc
ggcaccgtcgcccccggggtgcgcgaggcgctcgcccggcgcggcgtgctcggcacctcg
gtgctctggttcgaacgggactgggacggcgacggacggccgatcgccccggagaagtgg
cgccgggactgcctggccaccgccaccacccacgatctgccctccaccgccgcccggctg
accggcgaccatgtgacgctgcgccaccggctcggcctgctcacccgctccctggaggag
gagctgaccgccgacctcaccgacaccgccgaatggctggcgctcctcgcccggctgcgg
atgctccccgagggcgacggcgacgaggaggccgccgtccgggccgtccaccgcttcctg
ctgcgcacccccgcccggatgaccggcgtctggctccccgacaccgtcggcgaccgccgc
ccgcagaacctccccggcacctgggaccagtaccccaactggcgcctcccgatcgccgac
gccgaggggcatccggtcaccctggaggagatcaccgcctcgccccggctgcacgcgctg
atggacgtcctgcggccccgaaagcctcatacggcacccccgggcgagcgccgtccctag

DBGET integrated database retrieval system