KEGG   Streptomyces griseus: SGR_5647Help
Entry
SGR_5647          CDS       T00691                                 

Definition
(GenBank) putative low-affinity phosphate transport protein
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
sgr  Streptomyces griseus
Brite
KEGG Orthology (KO) [BR:sgr00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    SGR_5647
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4 DUF2070
Motif
Other DBs
NCBI-ProteinID: BAG22476
Kitasato: SGR5647
UniProt: B1W1S9
Position
complement(6624847..6626106)
Genome map
AA seq 419 aa AA seqDB search
MEHITLLLAIVVVTALVFDFTNGFHDTANAMATTISTGAMKPKTAVAMSAVLNLIGAFLS
VEVAKTISGGIVNEDGIRTEVIFAALVGAILWNLLTWLLGLPSSSSHALFGGLIGAAVMS
AGWSSINGGTVVTKVLLPAIAAPLVAGIAAMLATRLTYRINRNVTDEGQLKSTAKGYRAG
QIASAGLVSLAHGTNDAQKTMGIITLALVTSGVLAPGSNPPMWVIVSAGVAIALGTYLGG
WRIIRTMGKGLTDLQPPQGFAAQTSAATVILASSHLGFSLSTTQSCSGAVMGAGLGRKGG
VVRWSTATRMFVAWGLTLPAAGLVGAGAEFLTKQGPWGIAVTAVILVGGSFAIWVASRRQ
PVDHTNVNDTGEDEPQGVVTTAMAAVQPPPVGGPASDLSTTIPAPASAPDDPARPPAKV
NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt
atggaacacatcacgctgctgcttgcgattgtggtcgtaacagctctcgtgttcgatttc
acgaacggtttccacgacaccgccaacgcgatggcgaccaccatctcgaccggcgcgatg
aagcccaagacagcggtggcgatgtccgccgttctcaacctgatcggcgcgttcctgtcg
gtggaggtcgccaagacgatctccggcgggatcgtcaacgaagacggcatcagaacagag
gtcatcttcgcggcgctcgtcggcgccatcctgtggaatctcctgacctggctgctgggc
ctgccgtccagctcctcgcacgccctgttcggcggactgatcggcgccgccgtcatgtcg
gcaggctggtcctcgatcaacggcggcaccgtcgtcacgaaggtgctgctccccgcgatc
gcggcccccctggtggccggtatcgccgcgatgctggccacgcggctgacgtaccggatc
aaccggaacgtcaccgacgagggtcagctcaagtcgaccgccaagggctaccgggccgga
cagatcgcctccgccggtctcgtctcgctcgcccacggcaccaacgacgcccagaagacg
atgggcatcatcacgctggcgctggtcaccagcggtgtcctcgcccccggctccaacccg
cccatgtgggtcatcgtctcggccggtgtggccatcgcgctcggcacctacctcggcggc
tggcgcatcatccgcaccatgggcaagggcctgaccgacctccagccgccgcagggcttc
gccgcccagaccagtgcggcgaccgtcatcctggcctcctcgcacctcggcttctcgctc
tccaccacgcagtcctgctccggggccgtgatgggcgcgggcctgggccgcaagggcggt
gtggtccgctggtccaccgccacccggatgttcgtcgcctggggcctgacgctcccggcc
gccggcctggtcggcgcgggcgccgagttcctcacgaagcagggcccctggggcatcgcc
gtcacggcggtcatcctggtgggcggttcgttcgcgatctgggtggcctcgcgccgccag
ccggtcgaccacaccaacgtcaacgacacgggcgaggacgagccccagggcgtcgtcacc
accgccatggccgcggtccagccgccgcccgtcggcggtcccgcctccgacctctcgacc
accatcccggccccggcctcggctcccgacgacccggcccggccgccggccaaggtgtaa

DBGET integrated database retrieval system