KEGG   Streptomyces griseus: SGR_6055Help
Entry
SGR_6055          CDS       T00691                                 

Definition
(GenBank) putative guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
sgr  Streptomyces griseus
Pathway
sgr00230  Purine metabolism
sgr01100  Metabolic pathways
Module
sgr_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:sgr00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    SGR_6055
Enzymes [BR:sgr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     SGR_6055
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_16 RsgA_GTPase AAA_29 AAA_18 AAA_33 ABC_tran AAA_22 AAA_25 AAA_30 CbiA CPT AAA_28 AAA_23 NTPase_1 Zeta_toxin AAA_24 Rad17
Motif
Other DBs
NCBI-ProteinID: BAG22884
Kitasato: SGR6055
UniProt: B1W467
Position
7077540..7078133
Genome map
AA seq 197 aa AA seqDB search
MAATSRGTSPVPPDVRPRLTVLSGPSGVGKSTVVAHMRTVHPEVWLSVSATTRKPRPGER
NGVHYFFVDDEEFDKLVANGELLEWAEFAGNRYGTPRRAVLDRLEAGEPVLLEIDLQGAR
LVRQSMDDARLVFLAPPSWEELVRRLTGRGTEAPEVIERRLAAAKIELAAEAEFDTTLVN
TSVEDVARELLTLMLQA
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
atggctgcaacatcccgggggacgtcccccgtacccccggacgtacgtccgcggctgacc
gtgctctccggcccctcaggggtcggcaagagcacggtcgtcgctcatatgcgcaccgtg
caccccgaggtctggctctccgtgtcggcgacgacgcgcaagccgcgccccggggagcgc
aacggcgtgcactacttcttcgtggacgacgaggagttcgacaagctcgtcgccaacggc
gaactgctggagtgggccgagttcgcgggcaaccgctacggcacgccccggcgcgccgtg
ctcgaccgcctggaggccggtgaaccggtcctgctggagatcgacctccagggcgcccgg
ctggtccgccagtcgatggacgacgcgcgtctggtcttcctggccccgccgagctgggag
gagctggtgcgccggctcaccggccggggcaccgaggcccccgaggtcatcgagcgccgg
ctcgccgccgcgaagatcgaactggccgccgaggccgagttcgacaccacgctcgtcaac
acctccgtcgaggacgtggcgcgtgagctgctaacgttgatgcttcaggcctag

DBGET integrated database retrieval system