KEGG   Streptomyces griseus: SGR_6306Help
Entry
SGR_6306          CDS       T00691                                 

Definition
(GenBank) putative 6-phosphofructokinase
  KO
K21071  ATP-dependent phosphofructokinase / diphosphate-dependent phosphofructokinase [EC:2.7.1.11 2.7.1.90]
Organism
sgr  Streptomyces griseus
Pathway
sgr00010  Glycolysis / Gluconeogenesis
sgr00030  Pentose phosphate pathway
sgr00051  Fructose and mannose metabolism
sgr00052  Galactose metabolism
sgr00680  Methane metabolism
sgr01100  Metabolic pathways
sgr01110  Biosynthesis of secondary metabolites
sgr01120  Microbial metabolism in diverse environments
sgr01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:sgr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SGR_6306
   00030 Pentose phosphate pathway
    SGR_6306
   00051 Fructose and mannose metabolism
    SGR_6306
   00052 Galactose metabolism
    SGR_6306
  Energy metabolism
   00680 Methane metabolism
    SGR_6306
Enzymes [BR:sgr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     SGR_6306
    2.7.1.90  diphosphate---fructose-6-phosphate 1-phosphotransferase
     SGR_6306
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase
Motif
Other DBs
NCBI-ProteinID: BAG23135
Kitasato: SGR6306
UniProt: B1W5H8
Position
complement(7481657..7482682)
Genome map
AA seq 341 aa AA seqDB search
MRIGVLTSGGDCPGLNAVIRSVVHRAVVDHGDEVIGFHDGWKGLLECDYRKLDLDAVGGI
LARGGTILGSSRVQPAHLRDGVERARGHVADLGLDAIIPIGGEGTLKAANLLSEAGLPIV
GVPKTIDNDIASTDVTFGFDTAVGVATEALDRLKTTAESHQRVLIVEVMGRHTGWIALHS
GMAAGAHAIVVPERPFDIDELTELVGKRFSAGKKFAIVVVAEGAKPREGSMQFEQGVKDI
YGHERFAGVATQLSGELEQRLGKEARPVILGHVQRGGTPTAYDRVLATRFGWHAVEAAHR
GEFGMLTALRGTDIVMVPLGEAVETLKTVPAERYAEAECVL
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgcgcattggcgtactcacctccggcggcgactgccccggcctcaacgccgtcatccgt
tccgtcgtgcaccgcgcggtggtggaccacggcgacgaggtcatcggcttccacgacggc
tggaagggcctgctggagtgcgactaccgcaagctcgaccttgacgcggtgggcggcatc
ctggcccgcggcggcacgatcctcggttcctcccgggtccagcccgcgcatctgcgcgac
ggcgtggagcgcgcccgcggccatgtcgcggacctcggcctggacgccatcatcccgata
ggcggcgagggcaccctcaaggcggcgaatctcctctccgaggccggtctcccgatcgtc
ggcgtccccaagaccatcgacaacgacatcgcctccaccgacgtcaccttcggcttcgac
accgccgtcggcgtcgccaccgaggccctggaccggttgaagaccaccgccgagtcgcac
cagcgggtgctgatcgtcgaggtcatgggacggcacaccggctggatcgccctgcactcc
ggcatggccgccggagcccacgccatcgtggtgcccgagcgccccttcgacatcgacgag
ctgaccgagctggtcggcaagcgcttctcggcgggcaagaagttcgccatcgtggtggtc
gccgagggcgccaagccgcgcgagggctccatgcagttcgagcagggcgtcaaggacatc
tacggccacgagcggttcgccggggtggccacgcagctctccggggagctggagcagcgg
ctcggcaaggaggcccgcccggtcatcctcggccacgtccagcgcggcggcacgcccacc
gcgtacgaccgggtcctggcgacccggttcggctggcacgcggtggaggcggcgcaccgg
ggcgagttcgggatgctgaccgcgctgcgcggcaccgacatcgtgatggtcccgctgggc
gaggccgtcgagacgctgaagacggtccccgccgagcggtacgccgaggcggagtgcgtg
ctctag

DBGET integrated database retrieval system