KEGG   Streptomyces griseus: SGR_6363
Entry
SGR_6363          CDS       T00691                                 

Definition
(GenBank) putative phosphopantothenoylcysteine synthetase/decarboxylase
  KO
K21818  cypemycin cysteine dehydrogenase (decarboxylating) [EC:1.3.99.36]
Organism
sgr  Streptomyces griseus
Brite
KEGG Orthology (KO) [BR:sgr00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    SGR_6363
Enzymes [BR:sgr01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.99  With unknown physiological acceptors
    1.3.99.36  cypemycin cysteine dehydrogenase (decarboxylating)
     SGR_6363
SSDB
Motif
Pfam: Flavoprotein
Other DBs
NCBI-ProteinID: BAG23192
Kitasato: SGR6363
UniProt: B1W5N5
Position
complement(7571569..7572141)
AA seq 190 aa
MNVEQFEGAELHLHVTGSISAALVPWWIHWLRQLNPDVVVNVSVSRSATQFVTVKALRHL
ANGQVWTDAWDDPSLPAEVNSGQSGAAECFIVFPATLDTLMRLAQGRADSPALLMLQVTD
RPIVIADTLPGSNEIVESNLKTLRLRPNIAFAPRVTGVRASNRAAAEVGFNLPGAIAVAN
EMVKKGSVHE
NT seq 573 nt   +upstreamnt  +downstreamnt
atgaacgtggagcagttcgagggtgcggagttgcaccttcatgtgacgggatccatcagc
gcggcactggttccctggtggattcactggctgcgacagctgaatcccgacgtggtcgtg
aatgtctccgtatcccggtccgccacgcagttcgtgacggtcaaggccttgcggcacctc
gccaacggccaggtgtggacggacgcgtgggatgatccgagcctgccggccgaggtcaat
tccgggcagagcggcgcggccgagtgcttcatcgtgttccccgcgaccctggacaccctg
atgcggctggctcagggccgggcggattcgcccgctctgctgatgctccaggtgacggac
cgccccatcgtgatcgccgacacgcttcccggatccaacgagatcgtggagagcaacctc
aagaccctgcggctccgtccgaatatcgcgttcgcaccacgggtgaccggagtgcgcgcc
agcaatcgcgcggcggccgaggtgggattcaatctccccggcgccatcgccgttgccaat
gagatggtgaagaaaggctctgtccatgagtga

DBGET integrated database retrieval system