KEGG   Streptomyces griseus: SGR_6518Help
Entry
SGR_6518          CDS       T00691                                 

Definition
(GenBank) putative aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
sgr  Streptomyces griseus
Pathway
sgr00260  Glycine, serine and threonine metabolism
sgr01100  Metabolic pathways
sgr01110  Biosynthesis of secondary metabolites
sgr01120  Microbial metabolism in diverse environments
sgr01130  Biosynthesis of antibiotics
sgr01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:sgr00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SGR_6518
Enzymes [BR:sgr01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     SGR_6518
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase Aminotran_5 Glyco_hydro_20 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: BAG23347
Kitasato: SGR6518
UniProt: B1VLF6
Position
7785254..7786315
Genome map
AA seq 353 aa AA seqDB search
MRTDARRHHDPQVRGFASDNYAGAHPEVLAALALANGGHQVAYGEDDYTGHLQRVMHSHF
GATAEAFPVFNGTGANVVALQALTDRWGAVICAESAHINVDEGGAPERMGGLKLLTVPTP
DGKLTPELIDRQAYGWDDEHRAMPQVVSITQNTELGTVYTPDEIRAICDHAHERGMKVHL
DGARIANAAASLDVPMRTFTNTVGVDVLSFGGTKNGAIFGEAVVVLNPDAVRAMKHLRKL
SMQLASKMRFVSVQLEALLARDLWLRNARHANAMAQRLAEGVRAIDGVEILYPVQANAVF
ARLPHAVSERLQKRFRFYFWDEAAGDVRWMCAFDTGEDDVDAFLQALKEEMAR
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
gtgaggaccgacgcgcgacgtcaccacgacccgcaggtacgcggcttcgccagtgacaac
tacgccggcgcgcacccggaggtcctcgcggccctcgcgctggccaacggcggccaccag
gtcgcctacggcgaggacgactacaccggccacctccagcgcgtgatgcacagccacttc
ggcgccaccgccgaggccttcccggtcttcaacggcacgggcgccaacgtggtggccctc
caggcgctcaccgaccgctggggcgccgtgatctgcgccgagtccgcgcacatcaacgtg
gacgagggcggcgcgcccgagcggatgggcgggctgaagctcctcaccgtgcccacaccg
gacggcaagctcaccccggagctcatcgaccggcaggcgtacggctgggacgacgagcac
cgggccatgccgcaggtcgtctcgatcacccagaacaccgagctgggcaccgtctacacc
cccgacgagatccgcgccatctgcgaccacgcccatgagcgcggcatgaaggtgcacctc
gacggggcccggatagccaacgccgccgcctcgctggacgtgccgatgcggacgttcacc
aacacggtcggcgtcgatgtgctgtccttcggcggcacgaagaacggcgcgatcttcggt
gaggccgtcgtcgtgctcaatccggacgcggtccgggcgatgaagcacctgcgcaagctc
tccatgcagctcgcctccaagatgcgcttcgtctccgtccagctggaggcgctgctcgcc
agggacctgtggctgcgcaacgcccggcacgccaacgccatggcccagcggctcgccgag
ggcgtgcgggcgatcgacggggtggagatcctctacccggtgcaggccaacgccgtgttc
gcccgccttccgcacgcggtcagcgagcgactccagaagcgcttccgcttctacttctgg
gacgaggcggccggggacgtccgctggatgtgcgcgttcgacaccggcgaggacgacgtc
gacgccttcctccaggcgctcaaggaagagatggcgcgctag

DBGET integrated database retrieval system