KEGG   Streptomyces griseus: SGR_6607Help
Entry
SGR_6607          CDS       T00691                                 

Definition
(GenBank) putative aldose 1-epimerase
  KO
K01785  aldose 1-epimerase [EC:5.1.3.3]
Organism
sgr  Streptomyces griseus
Pathway
sgr00010  Glycolysis / Gluconeogenesis
sgr00052  Galactose metabolism
sgr01100  Metabolic pathways
sgr01110  Biosynthesis of secondary metabolites
sgr01120  Microbial metabolism in diverse environments
sgr01130  Biosynthesis of antibiotics
Module
sgr_M00632  Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Brite
KEGG Orthology (KO) [BR:sgr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SGR_6607
   00052 Galactose metabolism
    SGR_6607
Enzymes [BR:sgr01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     SGR_6607
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim
Motif
Other DBs
NCBI-ProteinID: BAG23436
Kitasato: SGR6607
UniProt: B1VLP5
Position
7891826..7892923
Genome map
AA seq 365 aa AA seqDB search
MPTVHRKPFGRAHGQSEIDLWTLDSGTGVRAEILTYGGVLHGLTVPDTAGSPGPVVRSLP
ALDDYTDKNPYFGAIVGRYANRIAHGRFTLDGTTHHIPANDRGHALHGGPDGFHTKVWGA
TGERTETTAVLRLTLHSPDGDMGFPGALDVTATYTLDTTGTLAVDYRAVTDRPTVVNLTN
HSYLNLGDDDILGHTLQVDADAYLPVDAGSIPEGPPAPVAGTPFDLTAPRRIGERLDHRD
AQLRPAGGFDHCWVLRPAAPGTLRRAARLTAPGDRRTLELWTTEPGLQVYTANQLDGAFT
DGTGRRHQRHGSLCLETQHLPDSPNRPGHPSTVLRPGAVLRSRTEWRFPHLRPAADNRLR
PPAAP
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atgcccaccgtgcaccgcaaaccgttcggccgcgcccacgggcagagcgagatcgacctc
tggaccctcgactccggcaccggcgtccgggccgagatcctcacctacggcggtgtcctg
cacggcctcaccgtgccggacaccgccggcagccccggccccgtcgtccgctcactgccc
gcgctcgacgactacaccgacaagaacccgtacttcggggcgatcgtcggccggtacgcc
aaccgcatcgcccacggccgcttcaccctcgacggcaccacgcaccacatcccggccaac
gaccgcggccacgccctgcacgggggccccgacggcttccacaccaaggtctggggggcc
accggggaacgtacggagacgaccgccgtcctccggctcaccctgcacagccccgacggc
gacatgggcttccccggagcgctcgacgtcacggccacctacaccctggacaccaccggg
accctcgccgtcgactaccgggccgtcaccgaccggcccaccgtcgtcaacctcaccaac
cactcctacctcaacctcggcgacgacgacatcctcggccacaccctccaggtcgacgcc
gacgcctacctccccgtcgacgccggctccatccccgaaggcccgcccgccccggtggcc
ggcacccccttcgacctcaccgcgccccggcgcatcggcgaacgcctcgaccaccgcgac
gcccaactgcggccggccggcggcttcgaccactgctgggtcctgcgcccggccgccccc
ggaaccctgcgccgagccgcccgcctcaccgcccccggcgaccggcgcaccctggagctc
tggaccaccgaaccgggcctccaggtctacaccgccaaccagctcgacggcgcgttcacc
gacggcaccggccgccgccaccagcgccacggctcgctctgcctggagacccagcacctg
ccggactcgcccaaccgacccggccacccgagcacggtgctgcgccccggagccgtcctg
cgcagccgcaccgaatggcgtttcccgcacctgcggccggccgcggataaccggttgcgg
cccccggcggccccctga

DBGET integrated database retrieval system