KEGG   Streptomyces griseus: SGR_6928Help
Entry
SGR_6928          CDS       T00691                                 

Definition
(GenBank) putative secreted cellulase
  KO
K19668  cellulose 1,4-beta-cellobiosidase [EC:3.2.1.91]
Organism
sgr  Streptomyces griseus
Pathway
sgr00500  Starch and sucrose metabolism
sgr01100  Metabolic pathways
sgr02020  Two-component system
Brite
KEGG Orthology (KO) [BR:sgr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    SGR_6928
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    SGR_6928
Enzymes [BR:sgr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.91  cellulose 1,4-beta-cellobiosidase (non-reducing end)
     SGR_6928
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_6 CBM_3 fn3 RGI_lyase
Motif
Other DBs
NCBI-ProteinID: BAG23757
Kitasato: SGR6928
UniProt: B1VPK7
Position
8314956..8317085
Genome map
AA seq 709 aa AA seqDB search
MSSRGTTQHPPRALRRRAAAALSALVMGAALAVAVPGQALAADRVDNPYAGATAYVNPDW
SAKAAAEPGGDVIADEPSFVWMDRIAAIGGTPGARGLRAHLDTAVSQGADLFQVVIYNLP
GRDCAALASNGELGPTELSRYKDDYIDPIADILGDPAYASMRIVTLIEPDSLPNLVTNAG
GTAGSTPECATMKANGNYEKGIGYALHTLGALPNVYNYVDAAHHGWLGWDSNFVPAAQQF
KKAATTEGATVSDVHGFIVNTANYSALKEPHFAVTDSVNGTTVRQSRWVDWNYYVDELSF
AKALRTELVRQGFASDIGMLIDTARNGWGGSSRPTGPGPLTSADAYVDGGRTDRRIHAGN
WCNQSGAGIGERPTTAPEPGIDAYVWAKPPGESDGSSEPIDNDEGKGFDRMCDPTYTGNG
RNGFNLTGALPGSPVAGHWFSGQFQELLRNAHPPLDGGSGGEDDTQAPTVPTNLRVTAKS
SSSVTLAWTASTDDTGVTGYDVLRDGVRVGTTSTTTYTDTGVRASTAYSYSVRAKDAAGN
VSAGTPAAQVTTEAGGGTGTGALKAEYRNTDNSPTDNQIRMSLRLVNTGSAAIDLSTVTA
RYWFTPDGGASTFGTACDYAVLGCGNVTHGVRSASTPATGASHYLEVGFGGGSLAAGAST
GEIQLRINKSDWSAFQESDDYSRATNTAFADAPRIGVFTGSALAWGTAP
NT seq 2130 nt NT seq  +upstreamnt  +downstreamnt
atgagcagcagaggcaccacccagcaccccccgcgcgcacttcgcagaagggcggccgcc
gcactgtccgcactggtcatgggcgccgcactcgcggtggccgtacccggacaggcgttg
gccgccgaccgcgtcgacaacccctatgcgggcgccaccgcgtacgtgaaccccgactgg
tcggccaaggccgccgccgagcccggcggcgacgtcatcgcggacgagccctcgttcgtc
tggatggaccgcatcgccgcgatcggcggcacacccggtgcgcggggtctgcgcgcacac
ctcgacacggccgtgagccagggagccgacctcttccaggtcgtcatctacaacctgccc
ggccgggactgcgcggccctcgcctccaacggcgaactcggccccaccgagctgagccgc
tacaaggacgactacatcgaccccatcgccgacatcctcggcgaccccgcctacgcgagc
atgcgcatcgtcacgctcatcgaaccggactcgctgcccaacctcgtcaccaacgccgga
gggaccgccggctccacccccgagtgcgccaccatgaaggccaacggcaactacgagaag
ggcatcggatacgccctgcacaccctgggcgccctgcccaacgtgtacaactacgtcgac
gccgcccaccacggctggctcggctgggactccaacttcgtccccgcggcccagcagttc
aagaaggcggcgacgacggagggcgccaccgtctccgacgtgcacggcttcatcgtgaac
acggccaactattccgcgctcaaggagccgcacttcgcggtgaccgactccgtgaacggg
accacggtgcgccagtcgcgctgggtggactggaactactacgtggacgagctctcgttc
gcgaaggccctgcgcacggagctggtccgccagggcttcgcctccgacatcggcatgctc
atcgacaccgcccgcaacggctggggcggctcctcccggcccaccggaccgggaccgctg
accagcgccgacgcctacgtcgacggtggccgcaccgaccgccgcatccacgccggcaac
tggtgcaaccagagcggcgccggcatcggcgagcgccccacgaccgcccccgagccgggg
atcgacgcctacgtctgggccaagcccccgggcgagtccgacggcagcagcgagcccatc
gacaacgacgagggcaagggcttcgaccggatgtgcgatcccacgtacaccggcaacggc
cgcaacggcttcaacctcaccggcgccctgccgggctccccggtggccgggcactggttc
tccgggcagttccaggaactgctccgcaacgcccacccgccgctggacggcggcagtgga
ggcgaggacgacacccaggcgccgaccgtgcccacgaacctgcgggtgacggccaagtcc
agcagcagcgtcaccctggcctggaccgcttccacggacgacaccggcgtcaccgggtac
gacgtcctccgcgacggcgtccgggtggggacgacgtccacgacgacctacacggacacc
ggggtccgcgcctcgaccgcctacagctactccgtcagggccaaggacgcggcgggcaac
gtctcggcgggcaccccggccgcacaggtcaccaccgaggcgggcggcggcaccggaacg
ggagccctcaaggccgagtaccgcaacaccgacaactcgccgaccgacaaccagatccgg
atgtccctccgcctggtcaacaccggttcggccgcgatcgacctgtccacggtcacggcc
cgctactggttcacccccgacggcggtgcgagcaccttcggtaccgcctgcgactacgcg
gtgctcggctgcgggaacgtgacgcacggcgtccggtcggcgagcacacccgccaccggc
gccagccactacctcgaagtcggcttcggcggcggcagcctcgcggcgggcgcctcgacc
ggggagatccagctgcggatcaacaagagcgactggtcggcgttccaggagagcgacgac
tacagccgcgccaccaacacggccttcgccgacgccccgaggatcggcgtcttcaccggc
tccgccctcgcctggggcaccgcgccctga

DBGET integrated database retrieval system