KEGG   Streptomyces griseus: SGR_986Help
Entry
SGR_986           CDS       T00691                                 

Definition
(GenBank) putative D-amino acid oxidase
  KO
K00273  D-amino-acid oxidase [EC:1.4.3.3]
Organism
sgr  Streptomyces griseus
Pathway
sgr00260  Glycine, serine and threonine metabolism
sgr00311  Penicillin and cephalosporin biosynthesis
sgr00330  Arginine and proline metabolism
sgr00472  D-Arginine and D-ornithine metabolism
sgr01100  Metabolic pathways
sgr01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:sgr00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SGR_986
   00330 Arginine and proline metabolism
    SGR_986
  Metabolism of other amino acids
   00472 D-Arginine and D-ornithine metabolism
    SGR_986
  Biosynthesis of other secondary metabolites
   00311 Penicillin and cephalosporin biosynthesis
    SGR_986
Enzymes [BR:sgr01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.3  With oxygen as acceptor
    1.4.3.3  D-amino-acid oxidase
     SGR_986
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO FAD_binding_2 NAD_binding_8 FAD_binding_3 NAD_binding_7 Pyr_redox Thi4 Pyr_redox_2 HI0933_like NAD_Gly3P_dh_N 3HCDH_N AlaDh_PNT_C UDPG_MGDP_dh_N FAD_oxidored Pyr_redox_3
Motif
Other DBs
NCBI-ProteinID: BAG17815
Kitasato: SGR986
UniProt: B1VTX1
Position
1165051..1165983
Genome map
AA seq 310 aa AA seqDB search
MTVMAEVIVVGGGVVGLTTAVTLAERGLRVRVWSRDPAGATTSAVAGALWWPYRIEPAER
VGDWALATLAVYEELSGAPRETGVRRVAGLHGGERLAALGAWSAGLRDAVEVPEGLRVTL
PLLDMPVHLAWLERRLAAAGGAVERRAVTGFAEAAERSPVVVNCTGLGARELVPDAGVRP
VRGQLVAVENPGIEEWYTEADPASAATTYFFPQPGRLVLGGTAEADDPRTEPDPGTAREI
VARCARIRPEIAGARVLGHRVGLRPAREAGVRIGTEELPGGGLLVHNYGHGGAGVTVAWG
CARAAAALVG
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgtgatggccgaggtgatcgtggtgggcggcggggtcgtcggtctgaccaccgcc
gtgacgctggcggagcgcgggctgcgggtgcgggtctggtcgcgcgatccggccggggcg
acgacgtcggcggtggcgggggccctgtggtggccgtaccggatcgagccggccgagcgg
gtgggcgactgggcgctggcgacgctggcggtctacgaggagttgtcgggcgccccgcgg
gagaccggcgtacggcgggtggcggggctgcacggcggggagcggctcgcggcgctgggc
gcctggtcggccgggctgagggacgccgtggaggtgcccgaagggctgcgggtgaccttg
ccgctgctggacatgcccgtccacctggcgtggctggagcggcggctggcggccgccggc
ggtgcggtggagcggcgggcggtgacggggttcgcggaggcggcggagcggagcccggtg
gtggtgaactgcacggggctcggggcgcgcgagctggtgcccgacgccggggtgcggccg
gtgcgggggcagttggtcgcggtggagaacccggggatcgaggagtggtacaccgaggcg
gatccggcgtcggccgcgacgacgtacttcttcccgcagccgggccggctggtgctgggg
ggtacggcggaggcggacgatccgcgcaccgagcccgacccgggcacggctcgggagatc
gtggcgcggtgcgcgcggatccggccggagatcgccggcgcccgggtgctcgggcaccgg
gtggggctgcgtccggcgcgggaggccggggtgcggatcgggacggaggagctgccgggc
ggcggtctgctggtgcacaactacgggcacggcggcgcgggcgtgaccgtggcctggggg
tgcgcgcgggcggcggcggccctggtcggctga

DBGET integrated database retrieval system