KEGG   Streptomyces griseochromogenes: AVL59_24155Help
Entry
AVL59_24155       CDS       T04729                                 

Definition
(GenBank) ornithine carbamoyltransferase
  KO
K00611  ornithine carbamoyltransferase [EC:2.1.3.3]
Organism
sgs  Streptomyces griseochromogenes
Pathway
sgs00220  Arginine biosynthesis
sgs01100  Metabolic pathways
sgs01110  Biosynthesis of secondary metabolites
sgs01130  Biosynthesis of antibiotics
sgs01230  Biosynthesis of amino acids
Module
sgs_M00844  Arginine biosynthesis, ornithine => arginine
Brite
KEGG Orthology (KO) [BR:sgs00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    AVL59_24155
Enzymes [BR:sgs01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.3  ornithine carbamoyltransferase
     AVL59_24155
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OTCace_N OTCace PALP
Motif
Other DBs
NCBI-ProteinID: ANP52232
UniProt: A0A1B1B0D8
Position
5655846..5656811
Genome map
AA seq 321 aa AA seqDB search
MVNGKVPEDLLQVSDLSPQTMTEVLDLAAAMKQQPLGWDEDLRGGAIGCFFDKPSTRTRV
SLATAAHRLGMIAITLNPDEMQLGHGETAADTARVLSSYLDAITVRTFDHAAVEQMADAA
TIPVVNALTNTHHPCQSLADLLALREHFGTLKGMVAAFLGDGTSNTCNSFLAACAANGMH
LTIASPAAYAADPLSLARARELMAQTGGSVMVTTEPVDAVRTAQAIYAEVWVPMDKPHER
EERAASLAPYRVDDVLLTHAPRDAVALHCLPAVRGEEITSQVLDGPRSLAWRQAANRLPT
AQAVLHTLITTNRQKTPGQRT
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atggtgaacggcaaggtccccgaggacctcctccaagtcagcgacctgagcccgcagacc
atgacggaagtactggacctcgctgccgcgatgaagcagcagccactgggctgggacgag
gacctgcgaggcggcgccatcggctgcttcttcgacaagccgtccacccgtacccgggtg
tccctggccacggccgcccaccggctgggcatgatcgccatcaccctcaatccggacgaa
atgcagctcggacacggcgagactgccgccgataccgcccgcgtcctgtcgtcctacctc
gacgccatcacggtgcggactttcgaccacgccgcggtcgagcagatggccgacgccgcg
acgatcccggtcgtcaacgcgctcaccaacacccaccacccgtgccagtcgctggccgac
ctcctcgcgctgcgcgagcacttcggcaccctgaagggaatggtcgcagccttcctcggc
gacggcaccagcaacacctgcaattccttcctcgccgcctgcgcagcgaacggcatgcac
ctcaccatcgccagcccggccgcctacgcggccgacccgctcagcctcgcgcgggcccgc
gaactgatggcacagaccggcggctcggtcatggtcaccaccgaaccggtggacgccgtc
cgcaccgcgcaggccatctacgccgaggtgtgggtgcccatggacaagccccacgagcgc
gaggaacgcgccgccagccttgctccctaccgggtggacgatgtcctgctgacccacgcc
ccacgcgatgcagtggccctgcactgcctccccgccgtccgcggagaggaaatcacctcc
caagtactcgacggcccccgctccctggcctggcgccaggccgcgaaccgcctccccaca
gcccaggcggtcctgcacaccctcatcaccaccaaccgccagaagaccccagggcaacgc
acatag

DBGET integrated database retrieval system