KEGG   Streptomyces griseochromogenes: AVL59_45015Help
Entry
AVL59_45015       CDS       T04729                                 

Definition
(GenBank) N-acetylglucosamine-6-phosphate deacetylase
  KO
K01443  N-acetylglucosamine-6-phosphate deacetylase [EC:3.5.1.25]
Organism
sgs  Streptomyces griseochromogenes
Pathway
sgs00520  Amino sugar and nucleotide sugar metabolism
sgs01100  Metabolic pathways
sgs01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:sgs00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    AVL59_45015
Enzymes [BR:sgs01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.25  N-acetylglucosamine-6-phosphate deacetylase
     AVL59_45015
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidohydro_1 Amidohydro_3
Motif
Other DBs
NCBI-ProteinID: ANP55820
UniProt: A0A1B1BAI1
Position
10311235..10312362
Genome map
AA seq 375 aa AA seqDB search
MLSGASVVLPTGTVEEGQVIVDGTRITSTAPANAQVIDVRNHWVVPGFVDIHNHGGGGAS
FSGTVDDVLKAIRTHRLHGTTTLVASTVTDEMDLLVQQAGLLSELAEQGDIAGIHFEGPF
ISPCRKGAHSEELLRDPEPAEVRKLIDAARGKAKMVTLATELPGGIDSVRLLAEHGVIAA
VGHTDATYEQTVEAIDAGATVATHLFNAMPTLGHRSPGPIAALLEDERVTVELINDGTHL
HPAALELAFHHAGASRVAFITDAMDAAGIGDGRYMLGPLEVEVSEGVARLVEGGSIAGST
LTLDRAFKRAVTVDRLTVEDTVAALSANPARLLGLSDRIGSLEPGKDADLVLLDANFDLK
GVMRRGEWVVVPQLP
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
gtgctgtccggcgccagcgtggtcctccccaccggaacggtcgaagagggccaggtgatc
gtcgacggcacccgcatcaccagcacagccccagcaaacgcccaggtcatcgacgtacga
aaccactgggtggtccccggcttcgtcgacatccacaaccacggcggcggcggagcctcc
ttctccggcacggtggacgacgtactgaaagccatccgcacccaccgcctgcacggcacc
accaccctggtcgcctccaccgtcaccgacgagatggacctgctggtccagcaggccggg
ctgctgagcgagctggccgagcagggcgacatcgccgggatccacttcgaggggccgttc
atctcgccgtgccgcaagggcgcgcactccgaggagttgctgcgcgacccggagccggcc
gaggtgcgcaagctgatcgacgcggcccgcggcaaggcgaagatggtcaccctcgccacc
gagctgccgggcggcatcgattccgtacgactgctcgcggagcacggcgtgatcgccgcc
gtcggccacacggacgccacctacgagcagaccgtcgaggccatcgacgcgggcgccacg
gtcgccacccacctcttcaacgcgatgcccacgctcggccaccgctcccccggcccgatc
gcggccctgctggaggacgagcgggtgacggtcgagctgatcaacgacggcacgcacctg
caccccgcggcgctggagctggccttccaccacgcgggcgcctcccgggtcgccttcatc
accgacgcgatggacgcggccggcatcggcgacggccgctacatgctcggtccgctggag
gtggaggtcagcgagggcgtggcccggctggtggagggcggctcgatcgcgggctccacg
ctgaccctggaccgggcgttcaagcgggcggtgaccgtcgacaggctgacggtggaggac
accgtggcggcgctgtccgcgaacccggcccggctgctcggcctgtccgaccgcatcggg
tccctggagcccggcaaggacgccgacctggtcctgctggacgcgaacttcgacctcaag
ggcgtgatgcgccggggtgaatgggtggtcgtgccccaactgccctga

DBGET integrated database retrieval system