KEGG   Streptococcus gallolyticus subsp. gallolyticus ATCC 43143: SGGB_0555Help
Entry
SGGB_0555         CDS       T02018                                 

Gene name
trpB
Definition
(GenBank) tryptophan synthase beta chain
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
sgt  Streptococcus gallolyticus subsp. gallolyticus ATCC 43143
Pathway
sgt00260  Glycine, serine and threonine metabolism
sgt00400  Phenylalanine, tyrosine and tryptophan biosynthesis
sgt01100  Metabolic pathways
sgt01110  Biosynthesis of secondary metabolites
sgt01130  Biosynthesis of antibiotics
sgt01230  Biosynthesis of amino acids
Module
sgt_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:sgt00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SGGB_0555 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SGGB_0555 (trpB)
Enzymes [BR:sgt01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     SGGB_0555 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: BAK27448
UniProt: F5WZI7
Position
574526..575728
Genome map
AA seq 400 aa AA seqDB search
MSYNQPDTNGFYGKFGGQFVPETLMTAVIELDEAYREAKADPSFQEELDALLKNYVGRET
PLYYAERLTKHIGGAKIYLKREDLNHTGAHKINNALGQVLLAKRMGKKKIIAETGAGQHG
VATATAAALFDMECTIYMGEEDVKRQALNVFRMELLGAKVFSVTDGSRVLKDAVNAALRA
WVANIEDTHYIMGSALGPAPFPEMVRDFQSVIGQEAKEQYAEISGGKLPDAVLACVGGGS
NAIGLFYPFVEDESVALYGAEAAGHGLDTEEHAATFAKGRIGILHGALMNVLQDRHGQIM
EAFSISAGLDYPGVGPEHCHFKDIGRATYDSITDDEALEAFMLLSRLEGIIPALESSHAI
ALTQKVAKELGPDKSIIVCLSGRGDKDVVQVKERLEAEGK
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgagctataaccaaccagatactaatggattttacggaaaatttggtggacaatttgtt
cccgaaacgctgatgactgcggttatcgaacttgatgaagcttaccgcgaagctaaggca
gacccaagctttcaagaagaactcgatgcgcttttgaaaaattatgtcggtcgtgaaaca
ccgctttattatgcagagcgtttaacaaaacatatcggcggtgcgaaaatttacctcaaa
cgtgaagaccttaaccacacaggtgctcataaaattaataatgccctcggtcaagttctc
cttgctaaacgaatgggcaaaaagaaaatcattgccgaaactggtgctggtcaacacggg
gttgcaacagcaacagcagctgcactttttgacatggaatgtacgatttacatgggtgaa
gaggacgtgaaacgccaagcactcaatgttttccgtatggaattgctaggcgctaaagtc
ttttctgtaactgatggttcacgcgttttgaaagatgccgtaaatgcagcccttcgcgcg
tgggtagctaatatcgaagatacacactacatcatggggtcagctctcggacctgcacct
ttccctgaaatggttcgtgacttccaatctgttatcggtcaagaagcaaaggaacaatat
gcagagatttcaggaggaaaattgcctgatgctgtcctagcctgtgttggcggtggttca
aatgcgattggtcttttctatccatttgtcgaagatgaatcagttgctctttacggtgct
gaagcagcaggacatgggcttgatactgaagaacacgctgcaacatttgccaaaggacgt
ataggtattttgcatggtgctttgatgaatgttttgcaagaccgtcatggacaaatcatg
gaagctttctcaatctcagctggtcttgattatccaggcgttggtccagaacattgccat
tttaaagacattggtcgtgcaacatacgattctattaccgatgatgaagcacttgaagca
ttcatgcttctatcacgtttggaagggattattccggccctcgaatcaagtcatgccatt
gctttgactcaaaaagtggctaaggaattaggaccagataaatcaatcattgtttgtcta
tctggacgtggtgataaggatgttgtgcaagtaaaagaacgtttggaagcagaagggaaa
tag

DBGET integrated database retrieval system