KEGG   Streptococcus gallolyticus subsp. gallolyticus ATCC 43143: SGGB_1333Help
Entry
SGGB_1333         CDS       T02018                                 

Gene name
rluD3
Definition
(GenBank) ribosomal large subunit pseudouridine synthase D
  KO
K06180  23S rRNA pseudouridine1911/1915/1917 synthase [EC:5.4.99.23]
Organism
sgt  Streptococcus gallolyticus subsp. gallolyticus ATCC 43143
Brite
KEGG Orthology (KO) [BR:sgt00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:sgt03009]
    SGGB_1333 (rluD3)
Enzymes [BR:sgt01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.23  23S rRNA pseudouridine1911/1915/1917 synthase
     SGGB_1333 (rluD3)
Ribosome biogenesis [BR:sgt03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    SGGB_1333 (rluD3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PseudoU_synth_2 S4
Motif
Other DBs
NCBI-ProteinID: BAK28193
UniProt: F5X1N2
Position
complement(1376767..1377663)
Genome map
AA seq 298 aa AA seqDB search
MELIIKEAGVRLDKALADLTELSRSQANDEIKKGTVLVNGKAVKAKYAVKVGDVVTYEVP
KEEVLEYTAENIPLDIIYEDDDVAVVNKPQGMVVHPSVGHMSGTLVNALMYHIKDLSSIN
GVIRPGIVHRIDKDTSGLLMIAKNDKAHNALAAELKDKKSLRKYVAIVHGNIPNDRGVIE
APIGRSEKDRKKQAVTAKGKPAVTHFKVLERFGNYTLVELTLETGRTHQIRVHMAYIGHP
VAGDPLYGPRKTLKGHGQFLHAQTLGFTHPTTGETLTFTAEAPAIFKETLENLRNGKA
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atggagttaatcattaaggaagctggtgttcgtttagacaaggcgctagcagatttgaca
gaattgtcacgtagccaagctaacgatgaaatcaaaaaaggaacagttttggtcaatggc
aaagctgttaaagcgaaatatgctgtcaaagttggtgatgttgtcacttacgaagtgcca
aaagaagaagtgttagaatatacagctgaaaatattccacttgatattatttacgaagat
gatgacgttgctgttgtcaataaaccccaaggaatggtggttcatccgtcagttggtcat
atgtctggaacattagtgaatgccttgatgtaccacattaaagatttatcttcgattaac
ggtgtgattcgaccaggaattgtgcatcgtattgataaagacacttcaggtttgttgatg
attgctaaaaatgataaggctcacaacgcacttgcagcagaattgaaagataaaaaatca
cttcgtaaatacgttgcaattgttcatggtaatattccaaatgaccgtggtgtcattgaa
gcaccgattggacgttcagaaaaagaccgtaaaaaacaagctgtaacagcaaaaggcaaa
cccgctgtaactcattttaaggtcttggaacgttttggaaattatacattggttgagtta
actttggaaacagggcgtacacaccaaattcgtgtacacatggcttatattggtcaccct
gtcgctggtgatccgctttatggaccgcgtaaaacgctgaagggacatggtcaattcttg
catgctcaaacacttggttttactcatccaacaacgggagaaacattgactttcacggca
gaagcaccagctatttttaaagaaacattggaaaatttaagaaatggtaaagcttaa

DBGET integrated database retrieval system