KEGG   Streptococcus gallolyticus subsp. gallolyticus ATCC 43143: SGGB_1957Help
Entry
SGGB_1957         CDS       T02018                                 

Gene name
ltaA
Definition
(GenBank) threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
sgt  Streptococcus gallolyticus subsp. gallolyticus ATCC 43143
Pathway
sgt00260  Glycine, serine and threonine metabolism
sgt01100  Metabolic pathways
sgt01110  Biosynthesis of secondary metabolites
sgt01120  Microbial metabolism in diverse environments
sgt01130  Biosynthesis of antibiotics
sgt01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:sgt00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SGGB_1957 (ltaA)
Enzymes [BR:sgt01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     SGGB_1957 (ltaA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase Aminotran_5 Aminotran_1_2 Pyridoxal_deC
Motif
Other DBs
NCBI-ProteinID: BAK28811
UniProt: F5WX04
Position
complement(2010846..2011871)
Genome map
AA seq 341 aa AA seqDB search
MLHFENDYNKGIHPQLLQALVDSNQESLAGYGMDSYCAQAAEKIKEACHCPEAEIFFLSG
GTQTNQVVIDSLLTSYEGVIAAETGHVSTHEAGAIEFTGHKVLTLPSHQGKIQAAELATY
VDNFYHDGNHDHMVFPGMVYISHPTEYGTLYTKEELTTISDVCRQYQLPLFIDGARLGYG
LAAKETEVDLPTIAALSDVFYIGGTKMGAFIGEAVVFTKQNTPKHFVTTVKQHGALLAKG
WLIGVQFDRFFTDNLYFEIGEHAIKMAEQLKDILREKGYRFYLESPTNQQFIIIENAKLA
TLGEVLAYSFWEKYDDTHTVIRLATSWSTTQEDIDKLREVL
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgttacattttgaaaatgattataataaaggaattcatccacagctactccaagcgctt
gtggatagtaatcaagaaagtcttgctggttatggcatggatagctattgtgcacaggct
gcagaaaagataaaagaagcttgccattgccctgaagctgaaatcttctttttatcaggt
ggcacacagactaatcaagtggttatcgatagcttgttaacctcttacgaaggtgttatc
gctgctgaaacggggcatgttagcactcatgaagctggtgctattgaatttacaggacac
aaggtactaacacttccttctcatcaaggaaaaattcaggcggctgagcttgctacttat
gtggataacttttatcatgatggcaaccatgaccatatggtttttccagggatggtttac
atttctcacccaactgaatatggcacgctctacaccaaggaagaattgaccaccatttca
gatgtttgtcgtcaatatcaattgccactatttattgatggcgcacgtttaggatatggt
ttggcagctaaggagacagaggtcgatttgccaactattgctgcattgtcagacgtcttt
tatattggtggtaccaaaatgggagcctttattggtgaagccgtcgtgtttacaaaacaa
aatacaccaaaacattttgtgacaacagtcaagcagcatggagcacttttggcaaaaggt
tggctgattggtgtgcaatttgaccgtttctttacggataatctttattttgaaattggt
gagcacgctattaaaatggcagagcagttaaaagacattttacgtgaaaaaggctatcgt
ttctatctggaatcaccaacaaatcaacaatttatcattattgaaaatgctaaattagcc
actttaggtgaagtccttgcttatagcttctgggaaaaatatgacgatacacatacggtt
attcgtttggcaacaagctggtcaacaacgcaagaagatattgataaattacgagaggtt
ttatag

DBGET integrated database retrieval system