KEGG   Streptomyces glaucescens: SGLAU_05290
Entry
SGLAU_05290       CDS       T03327                                 

Definition
(GenBank) 3-ketoacyl-CoA thiolase/acetyl-CoA acetyltransferase
  KO
K00632  acetyl-CoA acyltransferase [EC:2.3.1.16]
Organism
sgu  Streptomyces glaucescens
Pathway
sgu00071  Fatty acid degradation
sgu00280  Valine, leucine and isoleucine degradation
sgu00281  Geraniol degradation
sgu00362  Benzoate degradation
sgu00592  alpha-Linolenic acid metabolism
sgu01100  Metabolic pathways
sgu01110  Biosynthesis of secondary metabolites
sgu01120  Microbial metabolism in diverse environments
sgu01212  Fatty acid metabolism
Module
sgu_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:sgu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    SGLAU_05290
   00592 alpha-Linolenic acid metabolism
    SGLAU_05290
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SGLAU_05290
  09109 Metabolism of terpenoids and polyketides
   00281 Geraniol degradation
    SGLAU_05290
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    SGLAU_05290
   00642 Ethylbenzene degradation
    SGLAU_05290
Enzymes [BR:sgu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.16  acetyl-CoA C-acyltransferase
     SGLAU_05290
SSDB
Motif
Pfam: Thiolase_N Thiolase_C ACP_syn_III ketoacyl-synt
Other DBs
NCBI-ProteinID: AIR97084
UniProt: A0A089X7K3
Position
complement(1214828..1215997)
AA seq 389 aa
MRDAVIVEAVRTPIGKGKPGGSLAHVHPVELLAHTLRTLVERSGVDPALIDDVIGGTVDQ
VGEQAMNTTRYAVLSAGFPESVPATTVDRQCGSSQQAVHFAAQGVLSGAYDLVVACGVES
MSRVPMWSNVPPGKDPFGPGVAERYPEGLVPQGISAELIAAKWSVTREQMDAFAVSSHHK
AATAWEQGLFDAEVAPLDGVTRDECVRPSSTPETLAGLKPAYYDPGFAERFPQIEWNVTA
GNASPLNDGASAVLITSSETAARLGLRPLARLHSFAVTGSDPLLMLTGVVPATEKVLRRA
RLRLDDIDLFEVNEAFSSVVLAWQQETGADPAKVNAHGGAIALGHPLGASGTRLTTTLVH
AMRARGARYALQTMCEAGGLANAMILEGV
NT seq 1170 nt   +upstreamnt  +downstreamnt
atgcgcgacgcagtcatcgtcgaagccgtacgcacccccatcggcaagggcaagccaggc
ggctccctcgcccacgtccaccccgtcgaactcctcgcccacaccctgcgcaccctcgtc
gagcgctcaggtgtcgaccccgcgctcatcgacgacgtcatcggcggcaccgtcgaccag
gtcggcgagcaggccatgaacaccacgcgttacgccgtgctgtcggcgggcttccccgag
tcggtcccggcgaccaccgtcgaccgccaatgcggctcctcccagcaggccgtgcacttc
gccgcccagggcgtcctctccggcgcctacgacctcgtcgtcgcctgcggcgtcgagtcg
atgagccgggtgcccatgtggtccaacgtgccgcccggcaaggaccccttcggtcccggc
gtcgccgagcgctaccccgagggcctcgtcccccagggcatcagcgccgagctgatcgcg
gccaagtggtcggtcacccgggagcagatggacgccttcgccgtctcctcgcaccacaag
gcggccaccgcctgggagcaggggctgttcgacgccgaggtggcccccctggacggggtc
acgcgtgacgagtgcgtacggccgtccagcaccccggagaccctggccggcctcaagccc
gcctactacgaccccgggttcgccgagcgcttcccgcagatcgagtggaacgtcaccgcg
ggcaacgccagccccctcaacgacggcgcctccgccgtgctcatcacgtcgagcgagacc
gcggcccgcctcggactgcgcccgctggcccggctgcacagcttcgccgtcaccgggtcc
gacccgctgctgatgctcaccggggtcgtcccggccaccgagaaggtgctgcgcagggcc
cgcctcaggctcgacgacatcgacctgttcgaggtcaacgaggcgttctccagcgtggtg
ctcgcctggcagcaggagaccggcgccgaccccgccaaggtcaacgcgcacggcggcgcc
atcgccctcggccacccgctgggcgccagcggcacccggctcaccaccaccctcgtgcac
gccatgcgcgcgcggggcgcccgctacgccctgcagaccatgtgcgaggcgggcggactc
gccaacgccatgatcctggaaggtgtctga

KEGG   Streptomyces glaucescens: SGLAU_25780
Entry
SGLAU_25780       CDS       T03327                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00632  acetyl-CoA acyltransferase [EC:2.3.1.16]
Organism
sgu  Streptomyces glaucescens
Pathway
sgu00071  Fatty acid degradation
sgu00280  Valine, leucine and isoleucine degradation
sgu00281  Geraniol degradation
sgu00362  Benzoate degradation
sgu00592  alpha-Linolenic acid metabolism
sgu01100  Metabolic pathways
sgu01110  Biosynthesis of secondary metabolites
sgu01120  Microbial metabolism in diverse environments
sgu01212  Fatty acid metabolism
Module
sgu_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:sgu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    SGLAU_25780
   00592 alpha-Linolenic acid metabolism
    SGLAU_25780
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SGLAU_25780
  09109 Metabolism of terpenoids and polyketides
   00281 Geraniol degradation
    SGLAU_25780
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    SGLAU_25780
   00642 Ethylbenzene degradation
    SGLAU_25780
Enzymes [BR:sgu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.16  acetyl-CoA C-acyltransferase
     SGLAU_25780
SSDB
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Other DBs
NCBI-ProteinID: AIS01094
UniProt: A0A089XCV6
Position
complement(5881114..5882331)
AA seq 405 aa
MPRTVRDVVFVDGVRTPFGKAGPKGIYHETRADDLVVKAIRELLRRNPGLDPKKIDEVAI
AATTQIGDQGLTIGRTAGILAGLPQSVPGYSIDRMCAGALTAVTTVAGSVAFGAYDIAIA
GGVEHMGRHPMGEGVDPNPRFVSEKLVDESALFMGMTAENLHDRYPQITKLRADEYAVRS
QEKAAKAYANGKIQADLVPVSVRRTNAEAGETGWGLVTADEPMRPGTTLENLQNLKTPFR
VHGRVTAGNAAGLNDGATASLIASEDFARENGLPVKMRLVSYSFAGVEPEVMGYGPIPAT
EKALAQAGLSISDIGLFEINEAFAVQVLAFLDHYGIADDDERVNQYGGAIAFGHPLASSG
VRLMTQLARQFEEQPHVRYGLTTMCVGFGMGATVIWENPNFEGDK
NT seq 1218 nt   +upstreamnt  +downstreamnt
gtgcctcgtaccgtcagggacgtcgtcttcgtcgacggcgtccgcaccccgttcggcaag
gcgggcccgaagggcatctaccacgagacccgagccgacgatctcgtcgtcaaggcgatc
cgggagctgctgcgccgcaaccccggcctggacccgaagaagatcgacgaggtcgccatc
gccgcgaccacgcagatcggcgaccagggcctgaccatcggccgcaccgcgggcatcctc
gcgggcctgccgcagtccgtccccggctactccatcgaccgcatgtgcgcgggcgcgctg
acggccgtcaccacggtcgccggctccgtcgccttcggcgcctacgacatcgccatcgcg
ggcggtgtcgagcacatgggccgccacccgatgggcgagggcgtcgacccgaacccgcgc
ttcgtctccgagaagctggtcgacgagtccgccctgttcatgggcatgacggcggagaac
ctgcacgaccgctacccgcagatcaccaagctgcgcgccgacgagtacgcggtgcgctcc
caggagaaggccgccaaggcgtacgccaacggcaagatccaggccgacctggtgccggtc
tccgtgcgccgcaccaacgcggaggcgggcgagacgggctggggcctggtcaccgccgac
gagccgatgcgcccgggcaccaccctggagaacctccagaacctgaagaccccgttccgc
gtccacggccgggtcaccgccggcaacgcggccggcctgaacgacggcgccaccgcctcg
ctcatcgcctccgaggacttcgcgcgcgagaacggcctgcccgtcaagatgcgcctggtc
tcctactccttcgcgggcgtcgagccggaggtcatgggctacggcccgatcccggccacc
gagaaggccctcgcccaggcgggcctgtcgatctccgacatcggcctgttcgagatcaac
gaggccttcgccgtccaggtcctggccttcctggaccactacggcatcgccgacgacgac
gagcgcgtcaaccagtacggcggcgccatcgccttcggccacccgctggcctcctccggt
gtccgtctgatgacgcagctggcccgccagttcgaggagcagccgcacgtccgctacggc
ctgaccaccatgtgcgtcggcttcggcatgggcgcgacggtcatctgggagaacccgaac
ttcgagggggacaagtga

DBGET integrated database retrieval system