KEGG   Streptomyces glaucescens: SGLAU_05805Help
Entry
SGLAU_05805       CDS       T03327                                 

Gene name
ribBA
Definition
(GenBank) Riboflavin biosynthesis protein RibBA
  KO
K14652  3,4-dihydroxy 2-butanone 4-phosphate synthase / GTP cyclohydrolase II [EC:4.1.99.12 3.5.4.25]
Organism
sgu  Streptomyces glaucescens
Pathway
sgu00740  Riboflavin metabolism
sgu00790  Folate biosynthesis
sgu01100  Metabolic pathways
sgu01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sgu00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    SGLAU_05805 (ribBA)
   00790 Folate biosynthesis
    SGLAU_05805 (ribBA)
Enzymes [BR:sgu01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.25  GTP cyclohydrolase II
     SGLAU_05805 (ribBA)
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.99  Other carbon-carbon lyases
    4.1.99.12  3,4-dihydroxy-2-butanone-4-phosphate synthase
     SGLAU_05805 (ribBA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DHBP_synthase GTP_cyclohydro2 DUF3088
Motif
Other DBs
NCBI-ProteinID: AIR97184
UniProt: A0A089X7U9
Position
complement(1330151..1331452)
Genome map
AA seq 433 aa AA seqDB search
MTTAPLLHGPDDLEDLALDPVEQAIADIAAGRPVVVVDDEDRENEGDLVIAAEKATPEIV
AFMMSECRGLICAPMEGDELDRLQLPQMVADNTESMQTAFTVSVDASGAHGVTTGISAAD
RATTLRLLAGGTAGPADFVRPGHVFPLRARPGGVLARNGHTEAAVDLARLAGLRPAGAIV
EIAGEDGRMLRLPELIPFARKHGLTIISIEDLIAYRRSAEPTVRREAEVHLPTRHGTFTA
YGYRSTVDGVEHVALVHGEIGDGTDLLVRMHSECLTGDVFHSLRCDCGPQLEASLERIQA
AGRGVVVYLRGHEGRGIGLLSKLRAYELQERGRDTLDANLELGLPADARDYGAGARILTD
LGVRSVRLMTNNPEKSDALARHGIEVVEREPMPVTAGEHNLRYLRTKRDRMGHDLPWLDG
PAVPASAATCGDQ
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
atgaccacggcccccctgctccacggccccgacgacctcgaggacctcgccctcgacccc
gtcgaacaggccatcgccgacatcgcggcgggccgcccggtcgtggtcgtcgacgacgag
gaccgcgagaacgagggcgacctcgtcatcgccgccgagaaggccacccccgagatcgtc
gccttcatgatgagcgagtgccgcggcctgatctgcgcccccatggagggcgacgaactc
gaccggctccagctcccgcagatggtcgcggacaacaccgagtcgatgcagaccgccttc
accgtctccgtcgacgcctccggcgcgcacggcgtgaccaccggcatctcggccgccgac
cgggccaccaccctccggctgctggccggcggcaccgccgggcccgccgacttcgtccgc
cccggtcacgtcttcccgctgcgcgcccggcccggcggcgtgctggcccgcaacggccac
accgaggcggccgtcgacctcgcccggctcgcgggcctgcgcccggccggcgccatcgtg
gagatcgccggcgaggacggccggatgctgcggctgcccgagctgatcccgttcgcccgc
aagcacggcctgacgatcatctccatcgaggatctgatcgcctaccggcgcagcgcggaa
cccacagtccgccgggaggccgaggtccacctgccgacccggcacggcaccttcaccgcg
tacggctaccgctccaccgtcgacggcgtcgagcacgtcgccctggtccacggcgagatc
ggggacggcacggacctgctggtccggatgcactccgaatgcctcaccggcgacgtcttc
cactccctgcgctgcgactgcggcccccagctggaggcctccctggagcgcatccaggcc
gccggccgcggcgtggtggtctacctgcgcggacacgagggccgcggcatcgggctgctg
tccaagctgcgcgcctacgagctccaggagcgcgggcgcgacaccctcgacgccaacctc
gagctgggcctgcccgccgacgcccgcgactacggcgccggcgcccgcatcctgacggac
ctcggcgtgcgcagcgtccgcctgatgaccaacaaccccgagaagtccgacgccctcgcc
cgccacggcatcgaggtcgtcgagcgcgagccgatgcccgtcaccgcgggcgagcacaac
ctccgctacctgcgcaccaagcgggaccggatgggccacgacctgccctggctggacggc
ccggcggtgccggcctccgcggccacctgcggcgaccagtag

DBGET integrated database retrieval system