KEGG   Streptomyces glaucescens: SGLAU_08215Help
Entry
SGLAU_08215       CDS       T03327                                 

Definition
(GenBank) putative low-affinity inorganic phosphate transporter
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
sgu  Streptomyces glaucescens
Brite
KEGG Orthology (KO) [BR:sgu00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    SGLAU_08215
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4 DUF2070
Motif
Other DBs
NCBI-ProteinID: AIR97655
UniProt: A0A089YVI6
Position
1872768..1874027
Genome map
AA seq 419 aa AA seqDB search
MEGISLILAIVVVTALAFDFTNGFHDTANAMATTISTGALKPKVAVAMSAVLNLVGAFLS
VEVANTISKGLVDESGIRPEVIFAALVGAILWNLLTWLVGLPSSSSHALMGGLVGATIAS
AGVGAVHGDVLVTKVLIPAIAAPLVAGVAAMIAARLTYTLGRKADGKAAAKGYRAGQIAS
AGLVSLAHGTNDAQKTMGIITLALVAGGSLAPDSDPPMWVILSAGVAIALGTYLGGWRII
RTMGKGLTDLQPQQGFAAQTSAATVILASSHLGFSLSTTHSVSGAVMGAGLGRKGGVVRW
STATRMFVAWGLTLPAAALVGALAEWVTGFGDWGTAVVAVFLVGSSFAIWKVSRREVVDH
TNVNDVDEAAEQEPPGVVTTAMAAVTPPPTAAAAEELAATIPAPASHAGSDPAPSQAAV
NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt
atggaaggcatctcgctgatcctcgcgattgtggtggtaaccgcactcgcgttcgatttc
acgaacggtttccacgacaccgccaacgcgatggccaccaccatctcgaccggtgcgctc
aagccgaaggtcgcggtggccatgtccgccgtcctcaacctcgtcggcgccttcctctcg
gtggaagtcgccaacaccatctccaagggcctggtcgacgagagcggcatacgtcccgag
gtcatcttcgcggcgctggtcggcgccatcctgtggaacctgctgacctggctggtgggg
ctgccgtcctcctcctcgcacgccctcatgggcggcctcgtcggcgccaccatcgcctcc
gcgggcgtcggcgccgtccacggcgacgtgctggtcaccaaggtgctgatcccggcgatc
gccgccccgctggtggcgggcgtcgccgcgatgatcgcggcccggctgacctacaccctc
ggcaggaaggccgacggcaaggccgcggccaagggctaccgggccgggcagatcgcctcc
gcgggcctggtctccctcgcccacggcaccaacgacgcccagaagacgatgggcatcatc
accctcgccctggtcgccggcggcagcctcgcccccgactccgacccgcccatgtgggtc
atcctctccgcgggcgtcgccatcgccctcggcacctacctcggtggctggcgcatcatc
cgcaccatgggcaagggcctcaccgacctccagccgcagcagggcttcgccgcccagacc
agcgccgcgacggtcatcctggcctcctcccacctcggcttctccctctccaccacgcac
tcggtctccggtgcggtgatgggcgcgggcctgggccgcaagggcggtgtggtccgctgg
tccaccgcgacccggatgttcgtcgcctggggcctgaccctgccggccgccgcgctggtc
ggcgcgctcgccgagtgggtgaccggcttcggcgactggggcaccgcggtcgtcgcggtc
ttcctcgtcggctccagcttcgcgatctggaaggtgtcccggcgcgaggtcgtcgaccac
accaacgtcaacgacgtcgacgaggccgccgagcaggagccgcccggcgtggtgaccacc
gccatggccgccgtgacgccgccgccgaccgccgccgcggccgaggagctggcggccacc
atcccggcccccgcctcgcacgccggctcggacccggcgccttcgcaggccgcggtctga

DBGET integrated database retrieval system