KEGG   Streptomyces glaucescens: SGLAU_08230Help
Entry
SGLAU_08230       CDS       T03327                                 

Gene name
cobQ
Definition
(GenBank) Cobyric acid synthase
  KO
K02232  adenosylcobyric acid synthase [EC:6.3.5.10]
Organism
sgu  Streptomyces glaucescens
Pathway
sgu00860  Porphyrin and chlorophyll metabolism
sgu01100  Metabolic pathways
Module
sgu_M00122  Cobalamin biosynthesis, cobinamide => cobalamin
Brite
KEGG Orthology (KO) [BR:sgu00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    SGLAU_08230 (cobQ)
Enzymes [BR:sgu01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.10  adenosylcobyric acid synthase (glutamine-hydrolysing)
     SGLAU_08230 (cobQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GATase_3 CbiA AAA_26 GATase SNO Peptidase_S51 DJ-1_PfpI Peptidase_C26
Motif
Other DBs
NCBI-ProteinID: AIR97658
UniProt: A0A089X3F3
Position
1875625..1877133
Genome map
AA seq 502 aa AA seqDB search
MNGGLLVAGTTSDAGKSVVTAGICRWLVRQGVKVAPFKAQNMSLNSFVTREGAEIGRAQA
MQAQACRIEPTALMNPVLLKPGGEQSSQVVLLGKPVGEMSARGYHGGRQQRLLGTVLDCL
AELRGAYDAVICEGAGSPAEINLRRTDIVNMGIARGARLPVLVVGDIDRGGVFASFFGTV
ALLSREDQELVAGFLVNKFRGDVSLLEPGLDMLRGLTGRPSYGVLPFRHGLGIDEEDGLR
VSLRGTVRESATAPPVGEDVLRVAVCAVPLMSNFTDVDALAAEPGVVVRFVDRPEELADA
DLVVVPGTRGTVRALEWLRERGLAGALVRRAAEGRPVLGICGGFQVLGEHIEDDVESRRG
HVDGLGVLPVRVRFAREKTLTRPVGEALGEPVEGYEIHHGVAHVLGGEPFLDGCRVGQTW
GTHWHGSLESDGFRRAFLREVAAAAGRRFVPAPDTSFAALREEQLDRLGDLIEQHADTDA
LWRLIESGAPQGLPFIPPGAPA
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atgaacggcggtctcctcgtcgccggcaccacctccgacgccggcaagagcgtcgtcacc
gccgggatctgccgctggctggtacggcagggggtcaaggtcgcgcccttcaaggcgcag
aacatgtccctcaactcgttcgtgacccgggagggcgcggagatcgggcgggcgcaggcc
atgcaggcgcaggcctgccgcatcgagccgaccgcgctgatgaacccggtgctgctcaag
cccggcggtgaacagagcagccaggtggtgctgctgggcaagccggtgggcgagatgagc
gcgcgcggctaccacggcgggcggcagcagcggctgctcggcaccgtcctcgactgtctc
gccgaactgcggggcgcgtacgacgcggtgatctgcgagggggcgggcagcccggccgag
atcaacctgcgccggaccgacatcgtgaacatggggatcgcgcggggcgcgcggctcccc
gtcctcgtcgtcggcgacatcgaccgcggcggcgtcttcgcctccttcttcgggacggtg
gcgctgctgtcgcgggaggaccaggaactggtcgccgggttcctcgtcaacaagttccgc
ggggacgtgtccctgctggagcccggcctcgacatgctccgcggcctgaccgggcggccc
tcctacggcgtgctgccgttccggcacggcctcggcatcgacgaggaggacggactgagg
gtgtcgctgcgcgggacggtccgggagtccgccaccgccccgcccgtcggggaggacgtg
ctgcgggtcgccgtctgcgcggtcccgctcatgtccaacttcaccgacgtggacgccctc
gccgccgaaccgggtgtcgtcgtccggttcgtggaccggccggaggaactggccgacgcc
gatctggtggtcgtcccgggcacgcgcggcacggtgcgggccctggagtggctgcgggag
cgcgggctggccggcgccctcgtgcgccgggccgccgagggacggcccgtgctcggcatc
tgcggcggcttccaggtgctcggcgagcacatcgaggacgacgtggagagccgccgcggc
cacgtcgacgggctgggggtcctgcccgtgcgggtgcgcttcgcccgcgagaagaccctg
acccggccggtcggggaagccctcggcgagcccgtggagggctacgagatccaccacggc
gtcgcccacgtcctgggcggggagcccttcctggacggctgccgggtcggccagacctgg
ggcacccactggcacggctccctggagtcggacggcttccggcgcgccttcctgcgcgag
gtggccgccgccgcgggccgccgcttcgtgccggccccggacacgtcgttcgccgcgctg
cgcgaggagcagctcgaccggctcggcgacctgatcgaacagcacgcggacacggacgcg
ttgtggcggctcatcgagtccggtgcgccgcaaggactgcccttcatccccccgggagcg
cccgcatga

DBGET integrated database retrieval system