KEGG   Streptomyces glaucescens: SGLAU_12670
Entry
SGLAU_12670       CDS       T03327                                 

Definition
(GenBank) putative hydroxymethylglutaryl-CoA lyase
  KO
K01640  hydroxymethylglutaryl-CoA lyase [EC:4.1.3.4]
Organism
sgu  Streptomyces glaucescens
Pathway
sgu00072  Synthesis and degradation of ketone bodies
sgu00280  Valine, leucine and isoleucine degradation
sgu00281  Geraniol degradation
sgu00650  Butanoate metabolism
sgu01100  Metabolic pathways
sgu01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sgu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    SGLAU_12670
  09103 Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    SGLAU_12670
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SGLAU_12670
  09109 Metabolism of terpenoids and polyketides
   00281 Geraniol degradation
    SGLAU_12670
Enzymes [BR:sgu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.4  hydroxymethylglutaryl-CoA lyase
     SGLAU_12670
SSDB
Motif
Pfam: HMGL-like DUF5755
Other DBs
NCBI-ProteinID: AIR98530
UniProt: A0A089YY01
Position
2911242..2912183
AA seq 313 aa
MTAGGLPMAVPVEGLPARVRIHEVGARDGLQNEKATVPTEVKAEFIRRLAAAGLTTIEAT
SFVHPRWVPQLADAEDLFPMVGDLPVDLPVLVPNERGLDRALALGARRVAVFASATESFA
KANLNRTVDEALAMFEPVVSRAKAEGGHVRGYLSMCFGDPWEGPVPVPQVVRVCRALRDM
GCDELSLGDTIGVATPGHVRALLTALDAEGIPVEALGVHFHDTYGQALANTLAALQHGVT
TVDASAGGLGGCPYAKSATGNLATEDLVWMLRGLGIDTGVDLGLLTATSVWMAEQLGRPS
PSRTVRALSHKEQ
NT seq 942 nt   +upstreamnt  +downstreamnt
atgacggccggcggacttcccatggccgtccccgtggaggggctgcccgcccgtgtccgc
atccacgaggtcggcgcccgggacggactgcagaacgagaaggcgacggtgcccacggag
gtcaaggcggagttcatccggcgcctcgccgccgcgggcctgacgacgatcgaggcgacc
agtttcgtccacccccggtgggtgccccagctcgccgacgcggaggacctgttcccaatg
gtcggcgacctccccgtggacctgccggtgctggtgcccaacgagcgcggcctggaccgc
gccctcgccctcggtgcccgccgtgtcgccgtgttcgccagcgccaccgagtccttcgcg
aaggccaacctcaaccgcacggtcgacgaggcgctggccatgttcgagccggtggtcagc
cgggcgaaggcggagggcgggcatgtgcgcggctacctctccatgtgcttcggggacccc
tgggagggcccggtgcccgtcccgcaggtggtccgggtctgccgggcgctgagggacatg
ggctgcgacgagctgagcctcggcgacaccatcggcgtggccacccccggacacgtccgg
gcgctcctcaccgcgctcgacgccgaaggcatcccggtcgaggcgctgggtgtgcacttc
cacgacacctacggccaggcgctcgcgaacaccctcgcggcgctccagcacggggtgacg
accgtcgacgcctcggcgggcggcctgggcggctgcccctacgcgaagtcggccaccggc
aatctcgccaccgaggacctggtgtggatgctgcggggcctcggcatcgacaccggcgtc
gacctcggcctgctcaccgccacgagcgtgtggatggccgaacaactgggccggcccagc
ccctcccgcaccgtccgtgccctgtcccacaaggagcagtga

DBGET integrated database retrieval system